Recombinant Full Length Dictyostelium Discoideum Frizzled And Smoothened-Like Protein L(Fsll) Protein, His-Tagged
Cat.No. : | RFL9727DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled and smoothened-like protein L(fslL) Protein (Q54PF8) (25-619aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-619) |
Form : | Lyophilized powder |
AA Sequence : | QEEYPIDQTGKCEPYIGDSQITKCSTFLPNINSIYVSANSTQKDSMKTLDNYFGLLLAVG SEKCKDSSLTYQTLCSMYLKECESFTDNSTLKTVSIPKRICRKTCNDVTKLCNIESLFNC SQNEPINNLPLCPLNYSIYDLSLVNGDSNYELQCYSPLSNDSIEIPVTNYCPFPLIYINS TDHSADEDRGYMFVSGNSNCVVPNPVPLYTPKQWDRLYDLSNSLSVLSCVGTLFLLFTFN ILNKKINRFDRMNSLFNGSVFMMSLSGVIILFAGGPRALIKDGGARISVWQDPLCSATGF IFQLFSIAAILFWVVMSFELWYKIKFMTKKLDLKKYYIPFIIIVSLVFSIIPLATKNYRM IRGNMHCWVHTTKLQNSLFWIPLGIAITIGTIFIGLVMFEIHRIVSANSKGGVLKLEIKS ILNVALIYLTFIYLFAFNFYMNGQEGVVYGQIESFYQCTLENDASECTIQGPSIGSLGFF IFCIRIYGVYCFILQGLNYRAYNIWKESIFFNNRFVSYIKNNILNIETSSTGSGGTSTTA SATTTTTTKKHNGIDSLNIDSAFSKNNESDDEDDYDPYKKSKNNITLKDIEVSKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fslL |
Synonyms | fslL; DDB_G0284585; Frizzled and smoothened-like protein L |
UniProt ID | Q54PF8 |
◆ Recombinant Proteins | ||
PRR11-13465M | Recombinant Mouse PRR11 Protein | +Inquiry |
VWF-4940D | Recombinant Dog VWF protein, His-tagged | +Inquiry |
SSR3-4871C | Recombinant Chicken SSR3 | +Inquiry |
AMPD2-658R | Recombinant Rat AMPD2 Protein | +Inquiry |
RFL10131CF | Recombinant Full Length Sideroflexin-5(Sfxn-5) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
SNCB-27206TH | Native Human SNCB | +Inquiry |
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL33-4179HCL | Recombinant Human MRPL33 293 Cell Lysate | +Inquiry |
Parathyroid-373H | Human Parathyroid Membrane Lysate | +Inquiry |
SERPINA1A-002MCL | Recombinant Mouse SERPINA1A cell lysate | +Inquiry |
ZWILCH-2103HCL | Recombinant Human ZWILCH cell lysate | +Inquiry |
DAPK1-602HCL | Recombinant Human DAPK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fslL Products
Required fields are marked with *
My Review for All fslL Products
Required fields are marked with *
0
Inquiry Basket