Recombinant Full Length Dictyostelium Discoideum Frizzled And Smoothened-Like Protein F(Fslf) Protein, His-Tagged
Cat.No. : | RFL3678DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Frizzled and smoothened-like protein F(fslF) Protein (Q54J77) (18-591aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-591) |
Form : | Lyophilized powder |
AA Sequence : | FEIPKGFGIGLVIPDAECLNYIGDPIDQQLCNSKLQNNGDRIYTTTNSQIDSQTNIKKSF EAITFLQDQCKDLLFAQFGICDIYLAPCIEVTLTPLKSISLPQRFCKSVCDRMVSNCPRL EEQMDCSNSFLFPEIGTFYDLSPYGYTIDNGTFAVPCSDPTIFFNQVSSNSSFIEICPSP LLLKNSSDPEYAANKGYSYLSPSNCVLPCPVPNYSNQKWDQLLTMSKILSTISFILSLYN VLTFGIINKKVSDPHKCTCFFSGSIALVNLCDIITYGIGYEELLCPEPGRSAKQQLDPVC GLTGAFFHLGITYCVLWSMTMGLVLYCSVKRQKWFKFNYFLIGNTTFTITTVVIAAATSK FEAGLGSIECWIRDRWYAISLFWIPCGIALLIGSFCIIAVIHEVYKTSKKSISNRNDLLQ RELKPLLIVIFISGSFLYLFIFFFDIERKFGGYRSAVEDYVLCLLNGSQEECFTTGPSYV PYFLFYLVIRWFGIIFFLFYGTSNIARKIWVQNKIWKSISSSISPKSTPKSSPKNSDSKI NSNSTNNNNMILNDNNDKNLNEKKAVELESIKIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fslF |
Synonyms | fslF; DDB_0231315; Frizzled and smoothened-like protein F |
UniProt ID | Q54J77 |
◆ Recombinant Proteins | ||
GYS1-324H | Recombinant Human GYS1 Protein, His-tagged | +Inquiry |
HSPD1-022H | Active Recombinant Human HSPD1 Protein, His-tagged | +Inquiry |
SOX8-6296C | Recombinant Chicken SOX8 | +Inquiry |
EYA2-18H | Recombinant Human EYA2 protein, His-tagged | +Inquiry |
PTPN18-13679M | Recombinant Mouse PTPN18 Protein | +Inquiry |
◆ Native Proteins | ||
Troponin-01H | Native Human Troponin Protein | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
SERPINC1-5487R | Native Rabbit Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
TXNDC11-715HCL | Recombinant Human TXNDC11 lysate | +Inquiry |
FHL2-6223HCL | Recombinant Human FHL2 293 Cell Lysate | +Inquiry |
HMGXB4-5470HCL | Recombinant Human HMGXB4 293 Cell Lysate | +Inquiry |
UGT3A1-1881HCL | Recombinant Human UGT3A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fslF Products
Required fields are marked with *
My Review for All fslF Products
Required fields are marked with *
0
Inquiry Basket