Recombinant Full Length Dictyostelium Discoideum Dolichyl-Diphosphooligosaccharide--Protein Glycosyltransferase Subunit Swp1(Swp1) Protein, His-Tagged
Cat.No. : | RFL27257DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1(swp1) Protein (Q54HG9) (19-685aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-685) |
Form : | Lyophilized powder |
AA Sequence : | GSVQSKITTTRGISNVYSKNDINNIKQFISSKYNGNTKLYGESLKDTFYGVGVLTRIGET NIEATKDICKQTKEQLKQNKFTDIELVFNGVTILSELKCLQGESSSSLGNEQQLQDLLKN KLENGSLLEKTQAINIYFTLSSAKAIDSKTVSIIDPLLIQAVNSMVSLMDEDGTFKSVST DDEGNLQNTAAAYFALARLSHRLKSNEVDKLVAKVVNKVDTVLASADETTDSLYFNDLST TSSLLHGLLSLASVNDKVADVISNKQINQISEYLLRQKNVESLSDAYHLIVALKRCQKNS ISQPISLALVKSIYSPSGLNDIRVRVTDIFDQPIEASIVINKVVSSKNPRSTPILSGKEM KFQSSDNSFVADLSNENLKLGSYNFEFKVQPVDTDSYKSITNIQIITITGAVTVNDMKLS YAPKSDQLGSPKTTNEVQFGQKLPLIEIPSNNIARIFFRIASEAQPYQAQQVGIRFYSPA REAVVPATYSADAYSYTFTNKDACKILGCQSGNYQLDLIIGDQSITPLQWNFGEINLKFN QSTIPTNRYPEQLPISHNFRVAEKRPPQSISSLFTLLVLSPIAIFVIGLLFVGTNLGRFP TGMGFIYTIGFLGCISATGLLIVNYWLHSTMDVTLKNLALLMIPLVFFGHKSMSYYSNLS SSNIKKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | swp1 |
Synonyms | swp1; rpn2; DDB_G0289479; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit swp1; Oligosaccharyl transferase subunit swp1; Ribophorin II; RPN-II; Ribophorin-2 |
UniProt ID | Q54HG9 |
◆ Recombinant Proteins | ||
CDH17-0975H | Recombinant Human CDH17 Protein (Arg89-Ala406), N-His tagged | +Inquiry |
MMP2-889H | Active Recombinant Human MMP2 protein(Met 1-Cys 660) | +Inquiry |
CDC37-124H | Recombinant Human CDC37 protein, T7/His-tagged | +Inquiry |
Chrm1-5696R | Recombinant Rat Chrm1 protein, His-tagged | +Inquiry |
DENV_gp1-262H | Recombinant Human DENV_gp1, His-tagged | +Inquiry |
◆ Native Proteins | ||
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
Plasmin-250H | Active Native Human Plasmin | +Inquiry |
ALP-151P | Active Native Porcine Kidney Alkaline Phosphatase | +Inquiry |
Neuraminidase-008C | Active Native Clostridium perfringens Neuraminidase, Type V | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK1G1-662HCL | Recombinant Human CSNK1G1 cell lysate | +Inquiry |
FABP3-6477HCL | Recombinant Human FABP3 293 Cell Lysate | +Inquiry |
Uterus-450S | Sheep Uterus Lysate, Total Protein | +Inquiry |
GAD2-001MCL | Recombinant Mouse GAD2 cell lysate | +Inquiry |
DUSP7-516HCL | Recombinant Human DUSP7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All swp1 Products
Required fields are marked with *
My Review for All swp1 Products
Required fields are marked with *
0
Inquiry Basket