Recombinant Full Length Dictyostelium Discoideum Cyclic Amp Receptor 4(Card) Protein, His-Tagged
Cat.No. : | RFL15684DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cyclic AMP receptor 4(carD) Protein (Q9TX43) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MKVLQEINLTYSILVIADFSSIFGCLLVLIAFKKLKLLRNHITRVIACFCVSSLLKDIIS TGLTLSLGPQNEAGSTSFQCYLYAITITYGSLACWLWTLCLAFSIYNLIVKREPEPEKYE KFYHGVCWTIPLICVIVMLAKKTIEPVGNWCWISEKYVGYRFGLFYGPFFAIWIISAVLV GLTSRYTYSVIRNSVSDNKDKHMTYQFKLINYIIVFLLCWVFAIVNRILNGLGYYPTLPN ILHTYFSVSHGFFASVTFIYNNPLMWRYWGSKIFLIFAKFGYFVELQRRLDRNKNNNNPS PILNSYAATVYHSSTIESLSLQHNNDISNDNQQQQQQQQTPQQPQQQFQQQQSPTVIEMQ NLKQDQNIENNEQNENCYNTIDTNIEINTNKLNDNSFEITQPSNDLNTIENNNNYNNNNN NNNNNSLVIEKEKDEREKKDNKF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | carD |
Synonyms | carD; car4; DDB_G0277831; Cyclic AMP receptor 4; cAMP receptor 4 |
UniProt ID | Q9TX43 |
◆ Native Proteins | ||
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF22-927HCL | Recombinant Human KIF22 cell lysate | +Inquiry |
BIK-65HCL | Recombinant Human BIK lysate | +Inquiry |
SLC35A4-1733HCL | Recombinant Human SLC35A4 293 Cell Lysate | +Inquiry |
RPS6KA6-674HCL | Recombinant Human RPS6KA6 cell lysate | +Inquiry |
INHBC-346HCL | Recombinant Human INHBC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All carD Products
Required fields are marked with *
My Review for All carD Products
Required fields are marked with *
0
Inquiry Basket