Recombinant Full Length Dictyostelium Discoideum Cyclic Amp Receptor 1(Cara-1) Protein, His-Tagged
Cat.No. : | RFL22359DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum Cyclic AMP receptor 1(carA-1) Protein (P13773) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MGLLDGNPANETSLVLLLFADFSSMLGCMAVLIGFWRLKLLRNHVTKVIACFCATSFCKD FPSTILTLTNTAVNGGFPCYLYAIVITYGSFACWLWTLCLAISIYMLIVKREPEPERFEK YYYLLCWGLPLISTIVMLAKNTVQFVGNWCWIGVSFTGYRFGLFYGPFLFIWAISAVLVG LTSRYTYVVIHNGVSDNKEKHLTYQFKLINYIIVFLVCWVFAVVNRIVNGLNMFPPALNI LHTYLSVSHGFWASVTFIYNNPLMWRYFGAKILTVFTFFGYFTDVQKKLEKNKNNNNPSP YSSSRGTSGKTMGGHPTGDDVQCSSDMEQCSLERHPNMVNNQQNLNNNYGLQQNYNDEGS SSSSLSSSDEEKQTVEMQNIQISTSTNGQGNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | carA-1 |
Synonyms | carA-1; car1; DDB_G0273397; carA-2; DDB_G0273533; Cyclic AMP receptor 1; cAMP receptor 1 |
UniProt ID | P13773 |
◆ Recombinant Proteins | ||
TSPO-3462H | Recombinant Human TSPO, His-tagged | +Inquiry |
SSP-RS06590-0305S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS06590 protein, His-tagged | +Inquiry |
CTCFL-434M | Recombinant Mouse CTCFL Protein (1-636 aa), His-SUMO-tagged | +Inquiry |
SEMA3A-5527H | Recombinant Human SEMA3A Protein (Lys26-His276), N-His tagged | +Inquiry |
SE1151-4401S | Recombinant Staphylococcus epidermidis ATCC 12228 SE1151 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-29698TH | Native Human MMP9 | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
IgA-244H | Native Horse Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
C7orf53-7962HCL | Recombinant Human C7orf53 293 Cell Lysate | +Inquiry |
FOXD4L3-6158HCL | Recombinant Human FOXD4L3 293 Cell Lysate | +Inquiry |
SPANXB1-1544HCL | Recombinant Human SPANXB1 293 Cell Lysate | +Inquiry |
DAAM1-2111HCL | Recombinant Human DAAM1 cell lysate | +Inquiry |
MAP1LC3A-4514HCL | Recombinant Human MAP1LC3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All carA-1 Products
Required fields are marked with *
My Review for All carA-1 Products
Required fields are marked with *
0
Inquiry Basket