Recombinant Full Length Dictyostelium Discoideum Clptm1-Like Membrane Protein Cnrb(Cnrb) Protein, His-Tagged
Cat.No. : | RFL33974DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum CLPTM1-like membrane protein cnrB(cnrB) Protein (Q54RJ1) (1-619aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-619) |
Form : | Lyophilized powder |
AA Sequence : | MNNQGGAVAANGQRPQAQQQQQQGGIMGIISTLIRFMAIYYIASFAFSKFLGTGNNNNNG GVVLNNNNGTTNTSIPSNSVRLANSWPEGIEFNMKVYLSTSNETVGDWLVWEQDKLSYDW KDSNTIPTKNITFDTTPYLQNNGSLFAHIITSRRAYLNQPKSQLHKVHPLIVYLPKPKPK GKNLLEEKSKDEPEVEYDPTELISYWKPTLSLHLIVDHTIYPPDSIPKEIVSYFNITNGF YSPIIYCNEFWLYREHLKPVNETVKQLSIEINYSSMGLFKWQLQIQMQKSLDMQESFGGG GNSAMGGASVGDEFKRMLTDNDPWILGLTLIVSVLHTIFEFLAFKNDIQFWKNNKSMEGL SVKTITLNCVCMGIIFLYLLDNETSYMILASSGFGFLVEFWKLGKAMTIKITWMTSLPLP KRIEFINKDEYMSKTKQYDDMAMKYLSWLLFPLVIGTSIYSLYYHEHKSWYSWVVSSLVR TVYTFEFIMMTPQLFINYKLKSVSHLPWRVFMYRALNTFIDDLFAFIIKMPLLHRLSCLR DDIIFIVYLYQRWIYPVDKKRSHYGSEEAEEVQQQDKKEIKEKVEEREEEKQEEEEEEKE KEEESTSSSKVTKRKTKKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cnrB |
Synonyms | cnrB; DDB_G0283115; CLPTM1-like membrane protein cnrB |
UniProt ID | Q54RJ1 |
◆ Recombinant Proteins | ||
VEGFA-700H | Recombinant Human VEGFA Protein (Met1-Arg136) | +Inquiry |
ATP5B-346M | Recombinant Mouse ATP5B Protein (47-529 aa), His-SUMO-tagged | +Inquiry |
Gpr151-1581M | Recombinant Mouse Gpr151 Protein, His&GST-tagged | +Inquiry |
Uqcrh-6853M | Recombinant Mouse Uqcrh Protein, Myc/DDK-tagged | +Inquiry |
GMUR-1915B | Recombinant Bacillus subtilis GMUR protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
WIM-5415B | Native Bovine Vimentin | +Inquiry |
Lectin-1860W | Active Native Wheat Germ Agglutinin Protein, Biotinylated | +Inquiry |
PLG-1867B | Native Bovine PLG Protein | +Inquiry |
Lectin-1731R | Active Native Ricinus Communis Agglutinin I Protein, Rhodamine labeled | +Inquiry |
Plg-5465R | Native Rat Plasminogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRT86-4861HCL | Recombinant Human KRT86 293 Cell Lysate | +Inquiry |
C12orf39-8321HCL | Recombinant Human C12orf39 293 Cell Lysate | +Inquiry |
MRPL52-4157HCL | Recombinant Human MRPL52 293 Cell Lysate | +Inquiry |
C19orf47-8206HCL | Recombinant Human C19orf47 293 Cell Lysate | +Inquiry |
ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cnrB Products
Required fields are marked with *
My Review for All cnrB Products
Required fields are marked with *
0
Inquiry Basket