Recombinant Full Length Dictyostelium Discoideum Aac-Rich Mrna Clone Aac4 Protein(Aac4) Protein, His-Tagged
Cat.No. : | RFL25680DF |
Product Overview : | Recombinant Full Length Dictyostelium discoideum AAC-rich mRNA clone AAC4 protein(AAC4) Protein (P14198) (1-678aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium Discoideum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-678) |
Form : | Lyophilized powder |
AA Sequence : | MSLSNNQTQFVTVFVPIQLSIDVFRKMNNINSFVNDNLTNFPIVTVDQLIKVVNNNNNNN NNNNNNNNNNNNNTSISNNGDINNCLATFEQVQNNCFETCDFKATEREHYFASGKQIQES VLPEEEEEKISVNNFAMVTVEPNNCFVKAQQINSVAPLSLDNRNCVRRAHREVNTFVQVF DVCVFNLKVVNVATNESQVNLFNGGNVENICFDRSIQMPRSSADDFDWSSQQQSSWYSLA LSIIPIYHEIILVLCNWLVVAFYKYWQHQQQKQLPPHPLNIIVPNVSKRIAVNLNNQLIS LTFTNFLKNIFFLNNNNNNNNNNNNNNNNNNNNNNNNNNNNKTNNNQLNLSKEICNENLN FEEFNFEDESVCKYNRLTNSCENISKIQQVNEESELLDWFSDFEEMDSVLLQNGTEFDND HPMVKSQAPSITFKSLDQFIKYLEENNCVDDIEVSPCSKSHTFNRPVSTPRLIIKPTWCV YGDSLNTEFFHSCLKDKTCGDIIVDHFEPLVSSPTDFLLSNGGQRILDTPNAGGSSVWSE VLSFEVLNQVFGAQLKKTETEIEYAPGSKITDFSVDINNSHIGVSVVRIINFFDLNGRTY KAVFTPEYARNLLYKKLFGVIASTEAVVDKWEKQILYVWTTSSCVADIIVQEYWKVPAKL RSNTLVYVNHATNSEFLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AAC4 |
Synonyms | AAC4; DDB_G0267458; AAC-rich mRNA clone AAC4 protein |
UniProt ID | P14198 |
◆ Recombinant Proteins | ||
FAM154B-5510M | Recombinant Mouse FAM154B Protein | +Inquiry |
MBD3L5-4566H | Recombinant Human MBD3L5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RODA-1594N | Recombinant Neosartorya Fumigata RODA Protein (19-159 aa), His-tagged | +Inquiry |
Id2-1208M | Recombinant Mouse Id2 Protein, MYC/DDK-tagged | +Inquiry |
YXEK-1890B | Recombinant Bacillus subtilis YXEK protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
Lectin-1801L | Active Native Lycopersicon Esculentum Lectin Protein, Biotinylated | +Inquiry |
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF14-2155HCL | Recombinant Human TNFRSF14 cell lysate | +Inquiry |
Ovary-786D | Dog Ovary Membrane Lysate, Total Protein | +Inquiry |
Thyroid-449S | Sheep Thyroid Lysate, Total Protein | +Inquiry |
TSNAXIP1-714HCL | Recombinant Human TSNAXIP1 293 Cell Lysate | +Inquiry |
C1orf21-8167HCL | Recombinant Human C1orf21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AAC4 Products
Required fields are marked with *
My Review for All AAC4 Products
Required fields are marked with *
0
Inquiry Basket