Recombinant Full Length Dictyostelium Citrinum Nadh-Ubiquinone Oxidoreductase Chain 4L(Nad4L) Protein, His-Tagged
Cat.No. : | RFL21036DF |
Product Overview : | Recombinant Full Length Dictyostelium citrinum NADH-ubiquinone oxidoreductase chain 4L(nad4L) Protein (P0C5X9) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dictyostelium citrinum (Slime mold) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MNLIDLILIAIYVIGISGLIFNKNNIINILIISELNLGTLGMLFVLASVELNDILGELSG LYILTFTAAESAIGLAIVVILYSKTGIINIRNLNKLKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nad4L |
Synonyms | nad4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | P0C5X9 |
◆ Recombinant Proteins | ||
MAP3K15-2585H | Recombinant Human MAP3K15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SULT1A3-112H | Recombinant Human SULT1A3 Protein, HIS-tagged | +Inquiry |
CCDC149-3932HF | Recombinant Full Length Human CCDC149 Protein, GST-tagged | +Inquiry |
ALDH18A1-449M | Recombinant Mouse ALDH18A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED15-12302Z | Recombinant Zebrafish MED15 | +Inquiry |
◆ Native Proteins | ||
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
Chitosan-003C | Native Crawfish Chitosan Water Soluble | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRM3-5735HCL | Recombinant Human GRM3 293 Cell Lysate | +Inquiry |
GPD1L-5808HCL | Recombinant Human GPD1L 293 Cell Lysate | +Inquiry |
PKN2-3150HCL | Recombinant Human PKN2 293 Cell Lysate | +Inquiry |
TRHDE-800HCL | Recombinant Human TRHDE 293 Cell Lysate | +Inquiry |
Temporal Lobe-505H | Human Temporal Lobe (Alzheimers Disease) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nad4L Products
Required fields are marked with *
My Review for All nad4L Products
Required fields are marked with *
0
Inquiry Basket