Recombinant Full Length Dickeya Dadantii Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL4252DF |
Product Overview : | Recombinant Full Length Dickeya dadantii NADH-quinone oxidoreductase subunit K(nuoK) Protein (C6C9P6) (1-100aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dickeya paradisiaca |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-100) |
Form : | Lyophilized powder |
AA Sequence : | MIPLQHGLLLAAILFVLGLTGLVIRRNLLFMLISLEIMINASALAFVVAGSYWGQSDGQV MYILAITLAAAEASIGLALLLQLYRRRQTLNIDTVSEMRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; Dd703_2541; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | C6C9P6 |
◆ Native Proteins | ||
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
Lectin-1849U | Active Native Ulex Europaeus Agglutinin I Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
SLFN5-611HCL | Recombinant Human SLFN5 lysate | +Inquiry |
MARC1-4246HCL | Recombinant Human MOSC1 293 Cell Lysate | +Inquiry |
CYYR1-7089HCL | Recombinant Human CYYR1 293 Cell Lysate | +Inquiry |
RNF139-2297HCL | Recombinant Human RNF139 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket