Recombinant Full Length Desulfovibrio Magneticus Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL11643DF |
Product Overview : | Recombinant Full Length Desulfovibrio magneticus NADH-quinone oxidoreductase subunit K(nuoK) Protein (C4XMN4) (1-103aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desulfovibrio magneticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-103) |
Form : | Lyophilized powder |
AA Sequence : | MIVPLSHVLAVAALLFAVGGVMAAARRSILLILIGVEFMLAAAGLAFAGAGLAWNNLDGQ AAVIIIMGLASAEAGLGLALLVHGRRGGGTDRADSYDRLGEES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; DMR_13340; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | C4XMN4 |
◆ Recombinant Proteins | ||
SIAE-694H | Recombinant Human SIAE Protein, His/GST-tagged | +Inquiry |
ASS1-12H | Active Recombinant Human ASS1 Protein (Full Length), N-6×His tagged | +Inquiry |
SPAM1-1530H | Active Recombinant Human SPAM1 protein, Fc-tagged | +Inquiry |
ALCAM-0349H | Recombinant Human ALCAM Protein (Trp28-Ala526), C-Fc-tagged | +Inquiry |
MEOX2-9729M | Recombinant Mouse MEOX2 Protein | +Inquiry |
◆ Native Proteins | ||
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
LDH-226H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
IgG-013L | Native Llama IgG, Protein G Purified | +Inquiry |
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLUL1-370HCL | Recombinant Human CLUL1 cell lysate | +Inquiry |
RPS6KA1-2162HCL | Recombinant Human RPS6KA1 293 Cell Lysate | +Inquiry |
RNASE4-2319HCL | Recombinant Human RNASE4 293 Cell Lysate | +Inquiry |
XG-264HCL | Recombinant Human XG 293 Cell Lysate | +Inquiry |
TMEM170A-990HCL | Recombinant Human TMEM170A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket