Recombinant Full Length Desulfococcus Oleovorans Upf0365 Protein Dole_0018 (Dole_0018) Protein, His-Tagged
Cat.No. : | RFL13994DF |
Product Overview : | Recombinant Full Length Desulfococcus oleovorans UPF0365 protein Dole_0018 (Dole_0018) Protein (A8ZRR1) (1-326aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desulfococcus oleovorans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-326) |
Form : | Lyophilized powder |
AA Sequence : | MNPNYIILFFLVVAVIVLFYFVGSSVSLWIQALVSGARVGLLNIVFMRFRKVPPKLIVES KIMATKAGLDISSDELESHYLAGGNVSRVVQALIAADKAKIELSFNRSAAIDLAGRDVLE AVQMSVNPKVIETPMIAAMAKDGIQLKAISRVTVRANIDRLVGGAGEETILARVGEGIVT TIGSADSHKHVLENPDLISKRVLEKGLDSGTAFEILSIDIADVDVGKNIGAELETDRAEA DKKIAQAKAEERRAMAYAREQEMKAQVEEMRAKVVEAEAKIPLAMANAFEKGNLGIMDYY RMKNIMADTQMRDTIGSPDRETPREK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Dole_0018 |
Synonyms | floA; Dole_0018; Flotillin-like protein FloA |
UniProt ID | A8ZRR1 |
◆ Recombinant Proteins | ||
CCN2-864C | Recombinant Chicken CCN2 Protein, His-tagged | +Inquiry |
BFSP1-6708C | Recombinant Chicken BFSP1 | +Inquiry |
PFD0110w-4928P | Recombinant Plasmodium falciparum (isolate 3D7) PFD0110w protein(24-269aa), N/A-tagged | +Inquiry |
RFL11479BF | Recombinant Full Length Bacillus Cereus Nadh-Quinone Oxidoreductase Subunit A(Nuoa) Protein, His-Tagged | +Inquiry |
PBPD-1249B | Recombinant Bacillus subtilis PBPD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
H3N2-02I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
ACSBG2-18HCL | Recombinant Human ACSBG2 cell lysate | +Inquiry |
SLC7A10-1699HCL | Recombinant Human SLC7A10 293 Cell Lysate | +Inquiry |
CSN3-412HCL | Recombinant Human CSN3 cell lysate | +Inquiry |
NRIP3-3694HCL | Recombinant Human NRIP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Dole_0018 Products
Required fields are marked with *
My Review for All Dole_0018 Products
Required fields are marked with *
0
Inquiry Basket