Recombinant Full Length Desulfitobacterium Hafniense Upf0060 Membrane Protein Dsy4629(Dsy4629) Protein, His-Tagged
Cat.No. : | RFL13377DF |
Product Overview : | Recombinant Full Length Desulfitobacterium hafniense UPF0060 membrane protein DSY4629(DSY4629) Protein (Q24NH4) (1-108aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desulfitobacterium hafniense |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-108) |
Form : | Lyophilized powder |
AA Sequence : | MFYAIILFILAGLAEIGGGYLVWLWLREAKPFWYGIIGGLILVLYGVIPTLQKFPSFGRV YAAYGGVFVILAVLWGWGIDKKVPDNYDWIGAVICLVGVSVMLWAPRN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DSY4629 |
Synonyms | DSY4629; UPF0060 membrane protein DSY4629 |
UniProt ID | Q24NH4 |
◆ Recombinant Proteins | ||
SCO5863-537S | Recombinant Streptomyces coelicolor A3(2) SCO5863 protein, His-tagged | +Inquiry |
ZHX3-6707R | Recombinant Rat ZHX3 Protein | +Inquiry |
RFL28680MF | Recombinant Full Length Maricaulis Maris Atp Synthase Subunit B 2(Atpf2) Protein, His-Tagged | +Inquiry |
IL10-1232C | Recombinant Chicken IL10 | +Inquiry |
PUM1-1809H | Recombinant Human PUM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
C4A-8392H | Native Human C4A | +Inquiry |
CA2-29D | Native Dog Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACPP-1880HCL | Recombinant Human ACPP cell lysate | +Inquiry |
FTSJ1-6124HCL | Recombinant Human FTSJ1 293 Cell Lysate | +Inquiry |
BPIFB6-175HCL | Recombinant Human BPIFB6 cell lysate | +Inquiry |
PC-3406HCL | Recombinant Human PC 293 Cell Lysate | +Inquiry |
LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSY4629 Products
Required fields are marked with *
My Review for All DSY4629 Products
Required fields are marked with *
0
Inquiry Basket