Recombinant Full Length Debaryomyces Hansenii Ph-Response Regulator Protein Palh/Rim21(Rim21) Protein, His-Tagged
Cat.No. : | RFL1559DF |
Product Overview : | Recombinant Full Length Debaryomyces hansenii pH-response regulator protein palH/RIM21(RIM21) Protein (Q6BPR6) (1-537aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Debaryomyces hansenii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-537) |
Form : | Lyophilized powder |
AA Sequence : | MYWRSDEWQEEIYPACEQLSLPEGLLISQNTSFGSQFISRSIFQQKCYKHSVPMLNTNNG LMLNKFAGLLPIAEQTWHDFTGNSSKGSFAYSVVPVLYSISISAVITWFLNIFVITNYTI KPSILLRASTTLSSIYLLITVIMAIIELHKQQKQGFLHGTKLFDCINSSLALNIIDLIVV FLLQINQVQIIMRIFSRQKDKRLTFFVGIFASITSQVLWAITRFHSFSDDSEAGDILPAF QYLVRIAMGVCYAALVSVFVLMKINYIIANKKIWLITLLTVILIYGPVAFFIADVSNAWV FELSEIFSVVTYDICVVIPWEWCNKYNSIMKAKEKEGVLGRKFYEDELYELDRFELFVDE EDEDHENNNNENDDESGNENDNERGNNDHNNRHGLSRNGENTHKGYRPVNFDGNDKGFGS IFETYRRTKETFLNITDHVIAKGLAIPRSASVFTGTPVSAHNDEVFRMDNLNHKRDDPAD MTLENQEDHRNTNRNNTIRFASNSDIHRTNNSTAQNRRDVFVYSTREVIIDASDTET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM21 |
Synonyms | RIM21; DEHA2E11396g; pH-response regulator protein palH/RIM21 |
UniProt ID | Q6BPR6 |
◆ Native Proteins | ||
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
IgG-224M | Native Mouse Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
USE1-481HCL | Recombinant Human USE1 293 Cell Lysate | +Inquiry |
Lung-317B | Bovine Lung Lysate | +Inquiry |
GUK1-5674HCL | Recombinant Human GUK1 293 Cell Lysate | +Inquiry |
NOL3-3768HCL | Recombinant Human NOL3 293 Cell Lysate | +Inquiry |
ZCCHC24-201HCL | Recombinant Human ZCCHC24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIM21 Products
Required fields are marked with *
My Review for All RIM21 Products
Required fields are marked with *
0
Inquiry Basket