Recombinant Full Length Dasypus Novemcinctus Aquaporin-2(Aqp2) Protein, His-Tagged
Cat.No. : | RFL-21776DF |
Product Overview : | Recombinant Full Length Dasypus novemcinctus Aquaporin-2(AQP2) Protein (P79164) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dasypus novemcinctus (Nine-banded armadillo) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | SVAFSRAVLAEFLATLIFVFFGLGSALSWPQALPSVLQIALAFGLAIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAAILHEITPPDVRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AQP2 |
Synonyms | AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment |
UniProt ID | P79164 |
◆ Recombinant Proteins | ||
AQP2-737R | Recombinant Rat AQP2 Protein | +Inquiry |
RFL-18498PF | Recombinant Full Length Procavia Capensis Habessinica Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
AQP2-0591H | Recombinant Human AQP2 Protein (His177-Ala271), N-GST-tagged | +Inquiry |
AQP2-372R | Recombinant Rhesus monkey AQP2 Protein, His-tagged | +Inquiry |
RFL-16839RF | Recombinant Full Length Rat Aquaporin-2(Aqp2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AQP2 Products
Required fields are marked with *
My Review for All AQP2 Products
Required fields are marked with *
0
Inquiry Basket