Recombinant Full Length Danio Rerio Transmembrane Protein 177(Tmem177) Protein, His-Tagged
Cat.No. : | RFL2889DF |
Product Overview : | Recombinant Full Length Danio rerio Transmembrane protein 177(tmem177) Protein (Q6PBI8) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MSSRFLKISVFIQKYRTPLLLIGCGGVFSANIFYHIFPDHTYKKVYQAWHKGEPASLSEK LQNIFQEVLKDSSISTSGNFSAFAAFGFHPVGAGVPWLPSGAQIGIPANFNSSTADLEGI TNRTILINGKELEWDSDSGVALKNSLVFSLEAQKFAIAREVARLGSGGPILHAAVAPVCL AGACVYSVALKQIFRFQAGSIIFRGVVNLLSLGLGVMTYVLAADSVSQWLDYRSDRRAAG LSRDYAKGGLEFYEKILTRNKTLRSLMGQKGEEMYAPSGNLFPAHLLQLRHATYTSRRDR ILNLLKNENV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tmem177 |
Synonyms | tmem177; zgc:73384; Transmembrane protein 177 |
UniProt ID | Q6PBI8 |
◆ Recombinant Proteins | ||
PRTN3-1556HFL | Recombinant Full Length Human PRTN3 Protein, C-Flag-tagged | +Inquiry |
TH-8763Z | Recombinant Zebrafish TH | +Inquiry |
p24-1040H | Recombinant HDV p24 protein, His&Myc-tagged | +Inquiry |
ITGA5-5724HF | Recombinant Full Length Human ITGA5 Protein | +Inquiry |
GSAB-1797B | Recombinant Bacillus subtilis GSAB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU1-3871HCL | Recombinant Human NEU1 293 Cell Lysate | +Inquiry |
GRIN1-5745HCL | Recombinant Human GRIN1 293 Cell Lysate | +Inquiry |
CXCR4-7161HCL | Recombinant Human CXCR4 293 Cell Lysate | +Inquiry |
GART-687HCL | Recombinant Human GART cell lysate | +Inquiry |
Kidney-100M | Mouse Kidney Tissue Lysate (0 Days Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All tmem177 Products
Required fields are marked with *
My Review for All tmem177 Products
Required fields are marked with *
0
Inquiry Basket