Recombinant Full Length Danio Rerio Tetraspanin-33(Tspan33) Protein, His-Tagged
Cat.No. : | RFL30015DF |
Product Overview : | Recombinant Full Length Danio rerio Tetraspanin-33(tspan33) Protein (Q5RH71) (1-281aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-281) |
Form : | Lyophilized powder |
AA Sequence : | MGNAKRATQNDEDYTFVSPVVKYLLFFFNMIFWIISLVLISIGVYSRIVKHETALACLTV DPALILMVVGILMFFITFCGCVGSLRENICLLQTFCIFLTIMFLLQLLAGVLGFVFSDKA RGKVTDMFDNAIKHYRDDLDLQNLIDYGQKQFNCCGGISFMDWSKNMYFNCSDDNPSRER CSVPFSCCLHAKEETIINTMCGHGMQALNYLAASAFINTNGCIDILVNWIHSNLFLLGGI ALGLTIPQLVGILLSQVLINQIQDQIKLQNYNQQHRSDPWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | tspan33 |
Synonyms | tspan33; zgc:92266; Tetraspanin-33; Tspan-33 |
UniProt ID | Q5RH71 |
◆ Recombinant Proteins | ||
TSPAN33-3059H | Active Recombinant Human TSPAN33 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
RFL35985MF | Recombinant Full Length Mouse Tetraspanin-33(Tspan33) Protein, His-Tagged | +Inquiry |
TSPAN33-9687M | Recombinant Mouse TSPAN33 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23135BF | Recombinant Full Length Bovine Tetraspanin-33(Tspan33) Protein, His-Tagged | +Inquiry |
TSPAN33-730Z | Recombinant Zebrafish TSPAN33 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All tspan33 Products
Required fields are marked with *
My Review for All tspan33 Products
Required fields are marked with *
0
Inquiry Basket