Recombinant Full Length Danio Rerio Selenoprotein N(Sepn1) Protein, His-Tagged
Cat.No. : | RFL11981DF |
Product Overview : | Recombinant Full Length Danio rerio Selenoprotein N(sepn1) Protein (Q3Y4E2) (1-557aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-557) |
Form : | Lyophilized powder |
AA Sequence : | MAADVDKTPAGEQKDDHEDRGTPSSRRGRSRFTQISSLFIIAAIPVIGVCIKYYLDIQFV KRHEAGLKALGADGLFFFSSLDTDHDLYLSPEEFKPIAEKLTGVAPPPEYEEEIPHDPNG ETLTLHAKMQPLLLESMTKSKDGFLGVSHSSLSGLRSWKRPAISSSTFYASQFKVFLPPS GKSAVGDTWWIIPSELNIFTGYLPNNRFHPPTPRGKEVLIHSLLSMFHPRPFVKSRFAPQ GAVACIRATSDFYYDIVFRIHAEFQLNDVPDFPFWFTPGQFAGHIILSKDASHVRDFHIY VPNDKTLNVDMEWLYGASETSNMEVDIGYLPQMELGAEGPSTPSVIYDEQGNMIDSRGEG GEPIQFVFEEIVWSEELRREEASRRLEVTMYPFKKVPYLPFSEAFSRASAEKKLVHSILL WGALDDQSCUGSGRTLRETVLESSPVLALLNQSFISSWSLVKELEDLQGDVKNVELSEKA RLHLEKYTFPVQMMVVLPNGTVVHHINANNFLDQTSMKPEDEGPGLSFSAGFEDPSTSTY IRFLQEGLEKAKPYLES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | selenon |
Synonyms | selenon; sepn; sepn1; Selenoprotein N; SePN; SelN |
UniProt ID | Q3Y4E2 |
◆ Recombinant Proteins | ||
RFL35704HF | Recombinant Full Length Human Mannosyl-Oligosaccharide 1,2-Alpha-Mannosidase Ia(Man1A1) Protein, His-Tagged | +Inquiry |
DGCR6-7535H | Recombinant Human DGCR6, His-tagged | +Inquiry |
DUSP8A-11127Z | Recombinant Zebrafish DUSP8A | +Inquiry |
CYHR1-2123M | Recombinant Mouse CYHR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27222AF | Recombinant Full Length Aquifex Aeolicus Protein Translocase Subunit Secd(Secd) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Mucin-232P | Native Porcine Mucin | +Inquiry |
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO6-6289HCL | Recombinant Human FBXO6 293 Cell Lysate | +Inquiry |
NFIA-3853HCL | Recombinant Human NFIA 293 Cell Lysate | +Inquiry |
CSF1R-2091MCL | Recombinant Mouse CSF1R cell lysate | +Inquiry |
APIP-8795HCL | Recombinant Human APIP 293 Cell Lysate | +Inquiry |
Colon-17H | Human Colon Tumor Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All selenon Products
Required fields are marked with *
My Review for All selenon Products
Required fields are marked with *
0
Inquiry Basket