Recombinant Full Length Danio Rerio Protein Jagunal Homolog 1-A(Jagn1A) Protein, His-Tagged
Cat.No. : | RFL11487DF |
Product Overview : | Recombinant Full Length Danio rerio Protein jagunal homolog 1-A(jagn1a) Protein (Q5XJX0) (1-183aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-183) |
Form : | Lyophilized powder |
AA Sequence : | MASRAGPRAAGTDGGDFKHREKVASHYQMSASSKSEIKKLTVVHFLIWILVAAQVAVSHL NLVSHDLVAMPYQWEYPYLLSLVPSFIGALAMPKNNISYLVISMISAGLFSVAPLIFGAM EMFPLAQQLYRHGKAYRFIFGFSAVSVMYLLMVIAIQVHAWQIYYSKKLLDAWFNSTLEK KKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | jagn1a |
Synonyms | jagn1a; si:ch211-283e2.4; zgc:101070; Protein jagunal homolog 1-A |
UniProt ID | Q5XJX0 |
◆ Recombinant Proteins | ||
LCP1-392H | Recombinant Human LCP1 protein, His-tagged | +Inquiry |
DEFB43-1839R | Recombinant Rat DEFB43 Protein | +Inquiry |
PUS7L-7305M | Recombinant Mouse PUS7L Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPE-6802C | Recombinant Chicken SNRPE | +Inquiry |
DNAJC22-4243H | Recombinant Human DNAJC22 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Testosterone-01H | Native Human Testosterone | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
IgG-119S | Native Sheep Immunoglobulin G | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMI-3785HCL | Recombinant Human NMI 293 Cell Lysate | +Inquiry |
HNRNPA1L2-5451HCL | Recombinant Human HNRNPA1L2 293 Cell Lysate | +Inquiry |
Cotton-690P | Cotton Lysate, Total Protein | +Inquiry |
C19orf25-91HCL | Recombinant Human C19orf25 lysate | +Inquiry |
TBX21-1747HCL | Recombinant Human TBX21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All jagn1a Products
Required fields are marked with *
My Review for All jagn1a Products
Required fields are marked with *
0
Inquiry Basket