Recombinant Full Length Danio Rerio Protein Fam73A(Fam73A) Protein, His-Tagged
Cat.No. : | RFL21130DF |
Product Overview : | Recombinant Full Length Danio rerio Protein FAM73A(fam73a) Protein (Q5XJS0) (1-595aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-595) |
Form : | Lyophilized powder |
AA Sequence : | MNEDVLRSSHLPIKLAALHFLDLPLSVYYSLPQVSLSTGTKKLFAATAFGAVSLIIIARR FRRRKGRRKANSPVEQETFEFLTTIHLSKESDSQSVPQNSENPYTCNVVSGALYNKLSGS LPSLVSVRSRHSSSSSTCANGSNCWEEAGDAADVCNLLSLPVATPENLYLMGMELFEEAL RRWEQALTFRSRQAEDEGSCVSVKLGAGDAIAEESMEDIISADFIQKLESLLQRAYRLQE EFEGSLGVTDPTTHPTNVLLADKHMDLSVREELEDTCLRDSISIASTDSFVSAAELSEHR EMRSGHALGSLSPHPFYEDALQMAEEGKISCRVLRTEMLECLGDADFLAKLHCVRQACQV ILCERATRAFLADTGKRILSAIIAKARKSPKRFEEVFEEMISFLEHTDHWENTENELSSR GVKHMNFYDVVLDFILMDSFEDLENPPLSIQTVVNNRWLSNSFKETAVASSCWSVLKQKR QHMKVQDGFIAHFYAVCEHISPVLAWGFLGPKCTLQDFCCFFKEQVLFFLKDIFDLDKVR YFSLETLAEDILHLLHRRSDLLMAYLATDVIHHLNGCSDTSVHLVHSALLEAQVQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | miga1 |
Synonyms | miga1; fam73a; zgc:101625; Mitoguardin 1; Protein FAM73A |
UniProt ID | Q5XJS0 |
◆ Recombinant Proteins | ||
POLR2A-13091M | Recombinant Mouse POLR2A Protein | +Inquiry |
Bst1-7491R | Recombinant Rat Bst1 protein, His-tagged | +Inquiry |
CLDN4-256H | Active Recombinant Human CLDN4 protein, His-Twin-Strep-tagged(Detergent) | +Inquiry |
Wdr92-237M | Recombinant Mouse Wdr92 Protein, MYC/DDK-tagged | +Inquiry |
G2E3-1118Z | Recombinant Zebrafish G2E3 | +Inquiry |
◆ Native Proteins | ||
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
FN1-701H | Native Human Fibronectin 1 | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
LOX3-185G | Native Glycine max LOX3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTO1-1140HCL | Recombinant Human MSTO1 cell lysate | +Inquiry |
KCNG4-5061HCL | Recombinant Human KCNG4 293 Cell Lysate | +Inquiry |
DAB1-7087HCL | Recombinant Human DAB1 293 Cell Lysate | +Inquiry |
RGS10-2386HCL | Recombinant Human RGS10 293 Cell Lysate | +Inquiry |
IZUMO4-1502HCL | Recombinant Human IZUMO4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All miga1 Products
Required fields are marked with *
My Review for All miga1 Products
Required fields are marked with *
0
Inquiry Basket