Recombinant Full Length Danio Rerio Phosphatidylinositide Phosphatase Sac1-A(Sacm1La) Protein, His-Tagged
Cat.No. : | RFL16050DF |
Product Overview : | Recombinant Full Length Danio rerio Phosphatidylinositide phosphatase SAC1-A(sacm1la) Protein (A1L244) (1-586aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-586) |
Form : | Lyophilized powder |
AA Sequence : | MASTYNSFNLHTTAEKFYIEACDDGVGDVLAIDRVSTEKTLTVRKDVPPSAVTRPICGIM GTIRLVAGVYLIVITKKKKVGDLLGHAVWKASDFDIISYKKTVLHLTDNQMQDNKVFLSM LNSVLNTDGFYFATDYDLTHTLQRLSNTSPEFQEMTLLERADQRFVWNGHLLREFMAQPE LHRFVFPVIHGFIAMRSCCINGKIFDWNLISRRSCFRAGVRYYVRGIDSEGHAANFVETE QIIQYNGAKASFIQTRGSIPFYWSQRPNLKYKPKPQISKSINHLDGFQRHFDSQIIIYGK QVILNLVNQKGSEKPLEQAFAKMVGSLGNGMIKYIAFDFHKECSRMRWHRLQILVDTVAE LQDEFGYFLVDSDGSVQMQQDGTFRSNCMDCLDRTNVVQSLLARRSLQSQLERMAVLHVG QRIEEQADFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQWGLLMDGWNSMIRY YKNNFSDGFRQDSIDLFLGNYAVEEADMNTPLHEPKDWKFLTLPIIMVVAFSMCIICLLM AGDTWTETLAYVLFWGSASVVTGGVILFNGRDFVDAPRLVQKEKMD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sacm1lb |
Synonyms | sacm1lb; zgc:158642; Phosphatidylinositol-3-phosphatase SAC1-B; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein B |
UniProt ID | A1L244 |
◆ Recombinant Proteins | ||
RFL33911OF | Recombinant Full Length Odontella Sinensis Photosystem Q(B) Protein Protein, His-Tagged | +Inquiry |
GNAO1-1400M | Recombinant Mouse GNAO1 Protein (2-354 aa), His-tagged | +Inquiry |
PRDM16-8327H | Recombinant Human PRDM16 protein, MYC/DDK-tagged | +Inquiry |
COX4NB-27582TH | Recombinant Human COX4NB, T7 -tagged | +Inquiry |
RFL35799SF | Recombinant Full Length Salmonella Choleraesuis Cardiolipin Synthase(Cls) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
FSH-93P | Active Native Porcine FSH | +Inquiry |
HBA2-27784TH | Native Human HBA2 | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
DAP-7078HCL | Recombinant Human DAP 293 Cell Lysate | +Inquiry |
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
CDK10-326HCL | Recombinant Human CDK10 cell lysate | +Inquiry |
SLC25A3-1770HCL | Recombinant Human SLC25A3 293 Cell Lysate | +Inquiry |
IGFBP4-1231CCL | Recombinant Cynomolgus IGFBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sacm1lb Products
Required fields are marked with *
My Review for All sacm1lb Products
Required fields are marked with *
0
Inquiry Basket