Recombinant Full Length Danio Rerio Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Timm50) Protein, His-Tagged
Cat.No. : | RFL19165DF |
Product Overview : | Recombinant Full Length Danio rerio Mitochondrial import inner membrane translocase subunit TIM50(timm50) Protein (Q6NWD4) (27-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-387) |
Form : | Lyophilized powder |
AA Sequence : | STAPPLLDVVRPLSADTSSSSATGGLAQAILQERLQQQQKSQEQPPPEGEDSGHKQDEQG EDKKQKENTAYAKKMVLRLAGIMGLGGTVGIVYIFGSNSVDEQGNKIPDEFDNDVPVIQQ LRRTFKYFKDYRQMIIEPTSPKLLPDPLREPYYQPPYTLVLELTDVLLHPEWSLATGWRF KKRPGIDYLFQQLAPLYEIVIFTSETGMTAYPLIDSIDPQGFVMYRLFRDATRYMEGHHV KDVSCLNRDTSKVIVVDCKREAFGLQPFNGLALCKWDGNSEDRTLYDLAAFLKTIATSGV EDVRSVLENYAHEEDPIEAFKRRQAQLAREEEQRISEMAQQKKQGFSLGTIAGRFWSRKQ Q |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | timm50 |
Synonyms | timm50; tim50; zgc:66357; Mitochondrial import inner membrane translocase subunit TIM50 |
UniProt ID | Q6NWD4 |
◆ Recombinant Proteins | ||
RFL36870PF | Recombinant Full Length Populus Trichocarpa Casp-Like Protein Poptrdraft_788163 (Poptrdraft_788163) Protein, His-Tagged | +Inquiry |
Pqbp1-5090M | Recombinant Mouse Pqbp1 Protein, Myc/DDK-tagged | +Inquiry |
JAK3-467H | Active Recombinant Human JAK3 Protein, His-tagged | +Inquiry |
VSNL1-3757H | Recombinant Human VSNL1 protein, GST-tagged | +Inquiry |
PTPN21-3130H | Recombinant Human PTPN21 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Proteoglycans-50B | Native Bovine Proteoglycans | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
PLG -62R | Native Rabbit plasmin | +Inquiry |
Neuraminidase-013C | Active Native Clostridium perfringens Neuraminidase Agarose, Type VI-A | +Inquiry |
CAT-21H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHMP2A-7532HCL | Recombinant Human CHMP2A 293 Cell Lysate | +Inquiry |
COLO 320HSR-2145H | COLO 320HSR (human adenocarcinoma) whole cell lysate | +Inquiry |
HKDC1-795HCL | Recombinant Human HKDC1 cell lysate | +Inquiry |
C6orf223-126HCL | Recombinant Human C6orf223 lysate | +Inquiry |
Fetal Frontal Lobe-141H | Human Fetal Frontal Lobe Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All timm50 Products
Required fields are marked with *
My Review for All timm50 Products
Required fields are marked with *
0
Inquiry Basket