Recombinant Full Length Danio Rerio Kynurenine 3-Monooxygenase(Kmo) Protein, His-Tagged
Cat.No. : | RFL20776DF |
Product Overview : | Recombinant Full Length Danio rerio Kynurenine 3-monooxygenase(kmo) Protein (Q1RLY6) (1-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-474) |
Form : | Lyophilized powder |
AA Sequence : | METAFSHPPQSSSSKRKVIAVVGGGLVGSLNACFLAKRGFDVEVYESREDIRQAKVVKGR SINLALSHRGRQALKHVGMEDKIISKGIPMHARMIHNVNGKRSPIPYGKKGQYILSVDRA NLNKELLTAAEAYPNTRLNFNHKLHDWSPKTGTMTFIGSDGQKTETQADLIVGCDGAFSA VRKQFLRQSRFNYSQTYIPHGYMELTMPPKDGDFAMEPNYLHIWPRNTFMMIALPNLDRT FTCTLFMPFEDFEKIRTGDELLRFFHKYFPDSVPLIGVEALKQDFFRLPAQAMVSVKCCP YHLFEKCVLMGDAAHAVVPFYGQGMNAGFEDCLVFDEIMDQFNENLVAVLQEYTRVRVPD DHAIADLAMYNYIEMRAHVNSKYFIFRKYLDNLLHFFMPKTIVPLYTMVTFTRTRYNDAV NRWHWQNKVITRGLWLCGFVSAAGGTYVLVKNSHKLPSISAEQLWTRILALKLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | kmo |
Synonyms | kmo; zgc:136684; Kynurenine 3-monooxygenase; Kynurenine 3-hydroxylase |
UniProt ID | Q1RLY6 |
◆ Recombinant Proteins | ||
KMO-5779HF | Recombinant Full Length Human KMO Protein, GST-tagged | +Inquiry |
KMO-246HFL | Active Recombinant Full Length Human KMO Protein, C-Flag-tagged | +Inquiry |
Kmo-3728M | Recombinant Mouse Kmo Protein, Myc/DDK-tagged | +Inquiry |
KMO-35H | Active Recombinant Human KMO Protein, N-Met and 6×His tagged | +Inquiry |
Kmo-1559R | Recombinant Rat Kmo protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KMO-951HCL | Recombinant Human KMO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All kmo Products
Required fields are marked with *
My Review for All kmo Products
Required fields are marked with *
0
Inquiry Basket