Recombinant Full Length Danio Rerio G-Protein Coupled Receptor 183-B(Gpr183B) Protein, His-Tagged
Cat.No. : | RFL2129DF |
Product Overview : | Recombinant Full Length Danio rerio G-protein coupled receptor 183-B(gpr183b) Protein (B0UXR0) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MMSPDLDLNFSSNCNLYDHRPVARVLIPLVYSIICPVGLLGNALALHVVISSTTKINSIT LYSANLAVSDILFCLSLPLRAVYYGLGFHWPMGEVLCKAIALLFYLNCYAGVNFMTCLAV DRFVALVFPARLAKLRKAKNVRFVCLAIWLLVLAQTLPLLTIGLTKTEPDSSITCMEYPN FEGVFKGLPYMLIVAVVLGFGIPVMTIIACYSILTHKLHQAAKSNQLTERSGKTKKARGV IAGVVFVFVVCFSPYHIDILQYMIRKLLYETDCKELQSFQISLHITVCLMNLNSCLDPFV YFFACKGYKQKVMRMMKWQVGTHFSSVKNSAESSGTGDVLGTRRNNRIIMNNVGEDQQIC YQPSAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gpr183b |
Synonyms | gpr183b; si:dkey-22o12.5; G-protein coupled receptor 183-B |
UniProt ID | B0UXR0 |
◆ Native Proteins | ||
GPCP-28 | Active Native Glycerophosphocholine phosphodiesterase | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
IgA-240B | Native Bovine Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
FAM64A-6360HCL | Recombinant Human FAM64A 293 Cell Lysate | +Inquiry |
RHOT2-1507HCL | Recombinant Human RHOT2 cell lysate | +Inquiry |
VGLL3-1905HCL | Recombinant Human VGLL3 cell lysate | +Inquiry |
KIF3C-4945HCL | Recombinant Human KIF3C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gpr183b Products
Required fields are marked with *
My Review for All gpr183b Products
Required fields are marked with *
0
Inquiry Basket