Recombinant Full Length Danio Rerio Cleft Lip And Palate Transmembrane Protein 1-Like Protein(Clptm1L) Protein, His-Tagged
Cat.No. : | RFL15328DF |
Product Overview : | Recombinant Full Length Danio rerio Cleft lip and palate transmembrane protein 1-like protein(clptm1l) Protein (Q6DHU1) (1-538aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | zebrafish |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-538) |
Form : | Lyophilized powder |
AA Sequence : | MFPKTSFTSLIVGVFLLYVLHTCWVMYGIVYTKPCEKRRAESCISPYLAAKPRLQLSVYT ALRPNADGGHSLIHREEEFDVNTKFEKLVNVSLPKKTRKNGTLYAMVFLHQAGVSPWQDP HQVHLVTQLTTYMLPKPPEISLITGQDEPEKPDQQKQSSDSELDRPVSHWRSRLTLNVVS ENFLFDREALPGDVHRYMRVYQSGKKMIYLPLLFVDELSNRVKDLMEINSSSTELPLTIT YDSIALGKLRFWIHMQDAVYSLQQFGFTEKDADEIKGIFVDTNLYFLALTFFVAAFHLLF DFLAFKNDISFWKHKKSMVGMSSKAVLWRCFSTIVIFLYLLDEQTSLLVLVPAGIGSLIE VWKVKKAFKIHVIWRGLTPTFLFGKLDESEKRTEEYDTLAMKYLSYLLYPLCVGGAVYAL VFVKYKSWYSWIINSLVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFMYKAFNTFIDD VFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDRSRVNEYGVSYDEKPKGKSHED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | clptm1l |
Synonyms | clptm1l; zgc:92063; Cleft lip and palate transmembrane protein 1-like protein; CLPTM1-like protein |
UniProt ID | Q6DHU1 |
◆ Recombinant Proteins | ||
RFL3149PF | Recombinant Full Length Pongo Abelii Cleft Lip And Palate Transmembrane Protein 1-Like Protein(Clptm1L) Protein, His-Tagged | +Inquiry |
RFL31205BF | Recombinant Full Length Bovine Cleft Lip And Palate Transmembrane Protein 1-Like Protein(Clptm1L) Protein, His-Tagged | +Inquiry |
CLPTM1L-2083C | Recombinant Chicken CLPTM1L | +Inquiry |
CLPTM1L-3602M | Recombinant Mouse CLPTM1L Protein | +Inquiry |
CLPTM1L-523Z | Recombinant Zebrafish CLPTM1L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All clptm1l Products
Required fields are marked with *
My Review for All clptm1l Products
Required fields are marked with *
0
Inquiry Basket