Recombinant Full Length Cyanothece Sp. Upf0754 Membrane Protein Pcc7424_0748 (Pcc7424_0748) Protein, His-Tagged
Cat.No. : | RFL32592CF |
Product Overview : | Recombinant Full Length Cyanothece sp. UPF0754 membrane protein PCC7424_0748 (PCC7424_0748) Protein (B7KG11) (1-413aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanothece sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-413) |
Form : | Lyophilized powder |
AA Sequence : | MLIALELSTIWTIALPPITGAIIGYFTNDIAIKMLFRPYKARYIFKRRLPFTPGLIPRNQ ERLAKRVSDTIMGSLLTPEEIQNLARRLLKTERVQSAILWLLQLAIKQIRADKEQKTAKI LAGILSDLFGQSLPRLLKVLARRDDFLEAQINQIFDRILLEFRLTDLQARQLADWLLDTV ISPDILRQLLIDFLTDRNIQVIDEGFREKTSGTYWVVANIFGLRNTLTRLRTFCLDEKET ANTRLKELLLSLEMRTRLREWLQNLSLQNLPISTVRQLRKTTRDTVRSYIQQSGAQFLQD FNQSIDWEKLAIVVVNRLQASTVVTDSLEMISQELALILERYLEEDLERIVSQAIPILSI DQIIIEKIVATSPKELEAATEGIVKNELQAIVNLGGILGFFVGTIQTVILLLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PCC7424_0748 |
Synonyms | PCC7424_0748; UPF0754 membrane protein PCC7424_0748 |
UniProt ID | B7KG11 |
◆ Recombinant Proteins | ||
FOXA-8874Z | Recombinant Zebrafish FOXA | +Inquiry |
Tpd52l2-6593M | Recombinant Mouse Tpd52l2 Protein, Myc/DDK-tagged | +Inquiry |
RFL15931SF | Recombinant Full Length Salmonella Arizonae Upf0060 Membrane Protein Ynfa(Ynfa) Protein, His-Tagged | +Inquiry |
EIF4E2-28495TH | Recombinant Human EIF4E2, T7 -tagged | +Inquiry |
RFL34548RF | Recombinant Full Length Rhizobium Leguminosarum Bv. Viciae Glycerol-3-Phosphate Acyltransferase 2(Plsy2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
MMP3-26C | Collagenase Type 3 Protein | +Inquiry |
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF224-1997HCL | Recombinant Human ZNF224 cell lysate | +Inquiry |
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
GPR176-744HCL | Recombinant Human GPR176 cell lysate | +Inquiry |
PCDH8-1295HCL | Recombinant Human PCDH8 cell lysate | +Inquiry |
KLHDC3-4921HCL | Recombinant Human KLHDC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCC7424_0748 Products
Required fields are marked with *
My Review for All PCC7424_0748 Products
Required fields are marked with *
0
Inquiry Basket