Recombinant Full Length Cyanothece Sp. Upf0754 Membrane Protein Cyan7425_4067 (Cyan7425_4067) Protein, His-Tagged
Cat.No. : | RFL32670CF |
Product Overview : | Recombinant Full Length Cyanothece sp. UPF0754 membrane protein Cyan7425_4067 (Cyan7425_4067) Protein (B8HWF5) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanothece sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MALSVPPIAGAIIGYFTNDLAITMLFRPYKPIKIGQRTLPFTPGLIPANQERLARRISDA IMGSLLTPEELQKLTRRLLQTERVQAAIQWLLKMALDQVQSETEQKSAQVLAHILHDLLG SAIPRLIRVWARREDFLEAQLNQIFDQVLLELKLSEEQAGRIADWLLQVVLPPDRLRQTL IDFLTDRNIQVIDEDLREKTSGTYWVVANLFGVRNTLIRLRDFCIEEREACNVRLAELMD ALGVRQRLIEGLQDLSLQNLPVATVRQLRKVFRQNVRIYIQSQGLELVKGLSDSLNWEHV SLSILNRLRSSTAVTASLEVVSQELALVLERYLERDLEIIVEKAIPILNLDEVIVERVKA TTPQELEAAIQGIVKSELQAIVTLGGVLGLLIGIAQSVLLLVQGGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cyan7425_4067 |
Synonyms | Cyan7425_4067; UPF0754 membrane protein Cyan7425_4067 |
UniProt ID | B8HWF5 |
◆ Recombinant Proteins | ||
DNASE1-195H | Recombinant Human DNASE1 | +Inquiry |
YRKH-3944B | Recombinant Bacillus subtilis YRKH protein, His-tagged | +Inquiry |
SH-RS00405-6167S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS00405 protein, His-tagged | +Inquiry |
CD244-3039HF | Recombinant Full Length Human CD244 Protein | +Inquiry |
PROG-1162B | Recombinant Bacillus subtilis PROG protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRUB2-727HCL | Recombinant Human TRUB2 293 Cell Lysate | +Inquiry |
RNF25-1526HCL | Recombinant Human RNF25 cell lysate | +Inquiry |
EPHA2-2138MCL | Recombinant Mouse EPHA2 cell lysate | +Inquiry |
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
WEE1-1930HCL | Recombinant Human WEE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cyan7425_4067 Products
Required fields are marked with *
My Review for All Cyan7425_4067 Products
Required fields are marked with *
0
Inquiry Basket