Recombinant Full Length Cyanothece Sp. Cytochrome C Biogenesis Protein Ccsb(Ccsb) Protein, His-Tagged
Cat.No. : | RFL35987CF |
Product Overview : | Recombinant Full Length Cyanothece sp. Cytochrome c biogenesis protein CcsB(ccsB) Protein (B1WRN9) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanothece sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTISDSPQTPENLSLPKQGFRQLIKIVADLRLAIVLLLAIALFSISGTVIEQGETISFYQ QNYPEDPALFGFLTWKVILILGLNHVYTTWWFLSLLVLFGTSLTTCTFTRQFPALKAARK WNFYQKARQFEKLALSTELAINDLKFVNNLLEQKGYKTFQENQAIYARKGIIGKIGPIVV HAAMLIILGGAIWGALTGFLAQAMVPTGSEFKVNNIIEAGPLSQPQIPKDWGIRVNRFWI DYTPDGTIDQFYSDLSVINNDGEELKHKTIYVNEPLRYHGVTFYQTDWGIAGVQAQVNNS PIFQLPMALLNTNGNGRIWGTWIPTKPDLSEGVSLLAKDLQGTMMVYDQKGDLYSAVRPG MILDINGVRLKIYQLIGSTGLQIKADPGIPFVYTGFGLLMMGVIMSYVSHSQIWVLQEDE HCYIGGKTNRSQVTFERELLGIIESLEPEKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccsB |
Synonyms | ccsB; ccs1; cce_4132; Cytochrome c biogenesis protein CcsB |
UniProt ID | B1WRN9 |
◆ Recombinant Proteins | ||
Rrp15-5629M | Recombinant Mouse Rrp15 Protein, Myc/DDK-tagged | +Inquiry |
PCGF5-4777C | Recombinant Chicken PCGF5 | +Inquiry |
DNAJB9A-3086Z | Recombinant Zebrafish DNAJB9A | +Inquiry |
DNAJC19-11024Z | Recombinant Zebrafish DNAJC19 | +Inquiry |
ICAM2-797H | Recombinant Human ICAM2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
GG-183H | Native Human Gamma Globulin | +Inquiry |
Bcl2a1b-5322M | Native Mouse B-Cell Leukemia/Lymphoma 2 Related Protein A1b | +Inquiry |
C8-57H | Native Human Complement C8 | +Inquiry |
IgM-255H | Native Human Rheumatoid Factor IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIF23-928HCL | Recombinant Human KIF23 cell lysate | +Inquiry |
ETV4-6522HCL | Recombinant Human ETV4 293 Cell Lysate | +Inquiry |
MAPKAPK5-432HCL | Recombinant Human MAPKAPK5 cell lysate | +Inquiry |
ALAD-54HCL | Recombinant Human ALAD cell lysate | +Inquiry |
RAP1A-2530HCL | Recombinant Human RAP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ccsB Products
Required fields are marked with *
My Review for All ccsB Products
Required fields are marked with *
0
Inquiry Basket