Recombinant Full Length Cyanothece Sp. Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL25064CF |
Product Overview : | Recombinant Full Length Cyanothece sp. Cytochrome b559 subunit alpha(psbE) Protein (B7K626) (1-81aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanothece sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-81) |
Form : | Lyophilized powder |
AA Sequence : | MSGSTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDVFGTPRPDQYFTQER QELPIISDRYKASQQIQEFNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; PCC8801_4147; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | B7K626 |
◆ Recombinant Proteins | ||
E6-5678H | Recombinant Human E6 protein, His&His-tagged | +Inquiry |
RFL33396GF | Recombinant Full Length Gorilla Gorilla Gorilla C-X-C Chemokine Receptor Type 2(Cxcr2) Protein, His-Tagged | +Inquiry |
Use1-7654M | Recombinant Mouse Use1 protein, His&Myc-tagged | +Inquiry |
NEU3-301462H | Recombinant Human NEU3 protein, GST-tagged | +Inquiry |
FBXL12-2965H | Recombinant Human FBXL12 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HBsAg-8H | Native Hepatitis Surface Antigen subtype Ay protein | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
GPDH-119R | Active Native Rabbit Glycerol-3-phosphate Dehydrogenase | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FEN1-6264HCL | Recombinant Human FEN1 293 Cell Lysate | +Inquiry |
SIAH2-1850HCL | Recombinant Human SIAH2 293 Cell Lysate | +Inquiry |
RNASE3-2320HCL | Recombinant Human RNASE3 293 Cell Lysate | +Inquiry |
BACE1-3077MCL | Recombinant Mouse BACE1 cell lysate | +Inquiry |
AADACL2-9159HCL | Recombinant Human AADACL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket