Recombinant Full Length Cronobacter Sakazakii Upf0059 Membrane Protein Esa_01430 (Esa_01430) Protein, His-Tagged
Cat.No. : | RFL31163CF |
Product Overview : | Recombinant Full Length Cronobacter sakazakii UPF0059 membrane protein ESA_01430 (ESA_01430) Protein (A7MNM2) (1-187aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cronobacter sakazakii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-187) |
Form : | Lyophilized powder |
AA Sequence : | MNLSATLLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGVIEAITPLVGWLLGLL ATQFVLTWNHWIAFVLLVFLGGRMIIEGVRGCEEASEKIRRHSFWLLVTTAFATSLDAMA VGVGLAFLQVDIIKTALAIGCATLIMSTLGMMVGRFIGPLLGKRAEILGGVVLIGIGCQI LWSHFAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mntP |
Synonyms | mntP; ESA_01430; Putative manganese efflux pump MntP |
UniProt ID | A7MNM2 |
◆ Native Proteins | ||
CFH-23H | Active Native Human Complement factor H | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERMN-6548HCL | Recombinant Human ERMN 293 Cell Lysate | +Inquiry |
OTUD7B-3513HCL | Recombinant Human OTUD7B 293 Cell Lysate | +Inquiry |
IgG2a-1608MCL | Recombinant Mouse IgG2a cell lysate | +Inquiry |
HOXA6-5424HCL | Recombinant Human HOXA6 293 Cell Lysate | +Inquiry |
PDLIM3-1324HCL | Recombinant Human PDLIM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mntP Products
Required fields are marked with *
My Review for All mntP Products
Required fields are marked with *
0
Inquiry Basket