Recombinant Full Length Cricetulus Griseus Metallophosphoesterase 1(Mppe1) Protein, His-Tagged
Cat.No. : | RFL35641CF |
Product Overview : | Recombinant Full Length Cricetulus griseus Metallophosphoesterase 1(MPPE1) Protein (C7G3A0) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cricetulus griseus |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MALVRWRLRRGNFHLLSRVLLLKLTVVIISVLLFCEYFIYHLVIFQCHWPEVKTLAHGDR QKPVLKAMFLADTHLLGEIRGHWLDKLRREWQMERAFQTALWWLQPEVIFILGDIFDEGK WSTTEAWADDVQRFRKIFRHGSHVQLKVVIGNHDIGFHYQMSKYRIKRFEKVFSSERLFS WKGVNFVMVNSVAMEGDGCSICSEAEAELREISRKLNCSREVQGSSQCEGEQRLPFSAPV LLQHYPLYRASDANCSGEDAAPPEERNVPFEEKYDVLSREASQKLLWWLQPRLVLSGHTH SACEVLHPGGVPEVSVPSFSWRNRNNPSFIMGSLTSKDYALSKCYLPFEDRVLATYGAAA VFLVVLILAHLERLPSSFLFGWKLRKMHMRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPPE1 |
Synonyms | MPPE1; PGAP5; Metallophosphoesterase 1; Post-GPI attachment to proteins factor 5 |
UniProt ID | C7G3A0 |
◆ Recombinant Proteins | ||
MPPE1-3346C | Recombinant Chicken MPPE1 | +Inquiry |
MPPE1-957H | Recombinant Human MPPE1, His-tagged | +Inquiry |
MPPE1-3738R | Recombinant Rat MPPE1 Protein | +Inquiry |
MPPE1-5653M | Recombinant Mouse MPPE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9155PF | Recombinant Full Length Pongo Abelii Metallophosphoesterase 1(Mppe1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPPE1 Products
Required fields are marked with *
My Review for All MPPE1 Products
Required fields are marked with *
0
Inquiry Basket