Recombinant Full Length Coxiella Burnetii Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged
Cat.No. : | RFL33734CF |
Product Overview : | Recombinant Full Length Coxiella burnetii Glycerol-3-phosphate acyltransferase(plsY) Protein (B6IZN9) (1-193aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coxiella Burnetii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-193) |
Form : | Lyophilized powder |
AA Sequence : | MAFIISIIIAYLLGSLSFAVIVAKLMKLPDPRTTGSGNAGATNMLRVGGRQAAFYVLLGD AAKGLIAVLIARFLNVQGVSLAFVGLVAVLGHLFPVYFKFRGGKGVATMMGVLLGLSFWI ALFVIATWVIVVSIFRYSSVAALVSAVAAPIYTIIAGRTDYLFPVLIIAILLIWKHWENF QRLRKGTEDKVKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY |
Synonyms | plsY; CbuG_0771; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase |
UniProt ID | B6IZN9 |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
CFI-7556HCL | Recombinant Human CFI 293 Cell Lysate | +Inquiry |
SMARCAD1-1670HCL | Recombinant Human SMARCAD1 293 Cell Lysate | +Inquiry |
SLC20A2-1620HCL | Recombinant Human SLC20A2 cell lysate | +Inquiry |
AEN-8992HCL | Recombinant Human AEN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All plsY Products
Required fields are marked with *
My Review for All plsY Products
Required fields are marked with *
0
Inquiry Basket