Recombinant Full Length Corynebacterium Glutamicum Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL23891CF |
Product Overview : | Recombinant Full Length Corynebacterium glutamicum Undecaprenyl-diphosphatase(uppP) Protein (A4QEA1) (1-293aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Corynebacterium glutamicum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-293) |
Form : | Lyophilized powder |
AA Sequence : | MNEEITLLAAAADPAATENIGWVQTIVLSIVQGLTEFLPISSSGHLRIISELFWGADAGA SFTAVVQLGTEAAVLVFFAKEIWQIITGWFAGVFNKERRGFEYRMGWMIIVATIPVVILG VLGKDLIREALRNMWITASVLILFSLVFILAEKMGKKERDYDKLTMKDAIIMGLAQCLAL IPGVSRSGGTISAGLFLGLKREVATKFSFLLAIPAVLGSGLYSLPDAFAPSSGQAASGLQ LTVGTLFAFVVGYISIAWLMKFVANHSFSWFAAYRIPAGLLVMLLLALGMLNP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; cgR_1575; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | A4QEA1 |
◆ Recombinant Proteins | ||
KPNA2-484Z | Recombinant Zebrafish KPNA2 | +Inquiry |
OGG1-4763H | Recombinant Human OGG1 Protein (Ser31-Gly345), N-His tagged | +Inquiry |
CD86-10981H | Recombinant Human CD86, GST-tagged | +Inquiry |
Acpp-147M | Recombinant Mouse Acpp Protein, His-tagged | +Inquiry |
CLEC2H-3556M | Recombinant Mouse CLEC2H Protein | +Inquiry |
◆ Native Proteins | ||
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
PLG -37D | Native Canine plasminogen | +Inquiry |
LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-572M | MiniPig Skin Lysate, Total Protein | +Inquiry |
LHX9-4747HCL | Recombinant Human LHX9 293 Cell Lysate | +Inquiry |
CLEC1A-1458RCL | Recombinant Rat CLEC1A cell lysate | +Inquiry |
PCDHA8-1297HCL | Recombinant Human PCDHA8 cell lysate | +Inquiry |
ETS2-6525HCL | Recombinant Human ETS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket