Recombinant Full Length Colwellia Psychrerythraea Na(+)-Translocating Nadh-Quinone Reductase Subunit E(Nqre) Protein, His-Tagged
Cat.No. : | RFL34507CF |
Product Overview : | Recombinant Full Length Colwellia psychrerythraea Na(+)-translocating NADH-quinone reductase subunit E(nqrE) Protein (Q487D7) (1-207aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Colwellia Psychrerythraea |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-207) |
Form : | Lyophilized powder |
AA Sequence : | MEHYLSIFIKTIFIENMALSFFLGMCTFLAVSKKVSTAIGLGVAVVVVLGLAVPANQIIY QAILAPGALDSLMGITDPKESIDLSFLSFITFIGVIAALVQILEMLLDKYFPALYQALGI FLPLITVNCAIFGAVSFMVAKNLTLGESVVYGVGSGIGWMLAIVLMAGLREKMKYSDVPN GLKGLGITFITAGLMAFGFLSFGGISL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrE |
Synonyms | nqrE; CPS_1084; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E |
UniProt ID | Q487D7 |
◆ Recombinant Proteins | ||
RFL21052PF | Recombinant Full Length Pseudomonas Fluorescens Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged | +Inquiry |
hordein-454H | Recombinant Hordeum vulgare Gamma-hordein-3, His&Myc-tagged | +Inquiry |
ACVRL1-152R | Recombinant Rat ACVRL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPB4.1L4A-5232M | Recombinant Mouse EPB4.1L4A Protein | +Inquiry |
ALDH1A3-3634H | Recombinant Human ALDH1A3 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CII-250C | Native Chicken CII | +Inquiry |
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMC5-2759HCL | Recombinant Human PSMC5 293 Cell Lysate | +Inquiry |
CNTN1-996MCL | Recombinant Mouse CNTN1 cell lysate | +Inquiry |
ZNF544-2047HCL | Recombinant Human ZNF544 cell lysate | +Inquiry |
TIAL1-1779HCL | Recombinant Human TIAL1 cell lysate | +Inquiry |
LOC200383-1003HCL | Recombinant Human LOC200383 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nqrE Products
Required fields are marked with *
My Review for All nqrE Products
Required fields are marked with *
0
Inquiry Basket