Recombinant Full Length Coccidioides Posadasii Putative Dipeptidase Cpc735_014430 (Cpc735_014430) Protein, His-Tagged
Cat.No. : | RFL37CF |
Product Overview : | Recombinant Full Length Coccidioides posadasii Putative dipeptidase CPC735_014430 (CPC735_014430) Protein (C5PCN6) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coccidioides posadasii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MSTMSARDNEKGSARSQPSHAAASEIENVPRPSRQQSWTGTMIKVFIICACAGIVSKYII PLDSIFKSVHIDPHDYATRANRILSTTPLIDGHNDLPYLIRLETKNKIYDHEKLPFRTGL LSHTDQIKIQEGKLGGQFWSVFVECATDPNAEIDDPTWAVRDTLEQIDVTKRLVQEYPDL LEYCESASCAKAAFKRGKVGSFLGIEGGHQIGNSLASLRQVYDLGVRYITVTHNCDNAFA TAASTVAVGKPDLGLTDFGREFVKEMNRLGMLVDLSHVSHQTMRDILSVTKAPVMFSHSS SYALSKHLRNVPDDVLNGVTKNGGVVMVTFVPSFLKVDDPASATIHDAVDHILHVAKVAG WDHVGIGSDFDGTADVPEGLENVSKYPRLIELLLERGVTDEQARKLIGENILRVWSNVEE IAENIRALGEKPNEETWSGRKWTAAIDIPMPFMFKDSADKRKEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CPC735_014430 |
Synonyms | CPC735_014430; Putative dipeptidase CPC735_014430 |
UniProt ID | C5PCN6 |
◆ Recombinant Proteins | ||
CASP5-2595H | Recombinant Human CASP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ldlrap1-005M | Recombinant Mouse Ldlrap1 Protein, MYC/DDK-tagged | +Inquiry |
TUB-6659H | Recombinant Human TUB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENPP5-4324HF | Recombinant Full Length Human ENPP5 Protein, GST-tagged | +Inquiry |
RFL14104RF | Recombinant Full Length Rat Potassium Channel Subfamily K Member 18(Kcnk18) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
IgG-170G | Native Goat IgG Fc fragment | +Inquiry |
IgG-341D | Native Dog IgG | +Inquiry |
LDL-246H | Native Human Lipoproteins, Oxidized LDL (OX-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC17-4648HCL | Recombinant Human LRRC17 293 Cell Lysate | +Inquiry |
TNFSF10-892HCL | Recombinant Human TNFSF10 293 Cell Lysate | +Inquiry |
Heart-98M | Mouse Heart Tissue Lysate (14 Days Old) | +Inquiry |
Testis-447S | Sheep Testis Lysate, Total Protein | +Inquiry |
METRN-1279MCL | Recombinant Mouse METRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPC735_014430 Products
Required fields are marked with *
My Review for All CPC735_014430 Products
Required fields are marked with *
0
Inquiry Basket