Recombinant Full Length Cobalamin Biosynthesis Protein Cobd(Cobd) Protein, His-Tagged
Cat.No. : | RFL20310CF |
Product Overview : | Recombinant Full Length Cobalamin biosynthesis protein CobD(cobD) Protein (Q897L3) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Tetani |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MGLIDIIVAVLLDFAIGDPYWFPHPVIYIGKLISYLEEVGRKHFKSNKGLKTLGGLVVLT IAITSFGIPFLILWMVKDSFWIFHFLNIILIWTTLAAKSLKVEGKRVYYALKNEDIQEAR EKLSYIVGRDTRNLTEEEIIRADIETIMENTADGVIAPLFYAMIGGAPFAMMYKGINTMD SMLGYMNDKYIHLGFFPAKVDDVFNFIPARISGVLICLSAPIVKGNIIRSFKVMLRDRKN HKSPNCAYPEGAGAGVMGIQLGGTNVYFGKAVYKPTIGDRIKDLHHELINDSVKLMYASE TLMVIIYALTVTSYNLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cobD |
Synonyms | cobD; CTC_00721; Cobalamin biosynthesis protein CobD |
UniProt ID | Q897L3 |
◆ Recombinant Proteins | ||
Vegfa-172M | Active Recombinant Mouse Vegfa | +Inquiry |
RFL61CF | Recombinant Full Length Acetolactate Synthase-Like Protein (T26C12.1) Protein, His-Tagged | +Inquiry |
IKIP-3486H | Recombinant Human IKIP protein, His-tagged | +Inquiry |
FKBP4-1397C | Recombinant Chicken FKBP4 | +Inquiry |
MAP3K7CL-3782H | Recombinant Human MAP3K7CL Protein (Asp124-Ser242), His tagged | +Inquiry |
◆ Native Proteins | ||
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
Plg-32M | Native Mouse Plg protein | +Inquiry |
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
VZV-04 | Native Varicella Zoster Virus (VZV) Antigen | +Inquiry |
AEBP1-8321S | Native S. cerevisiae AEBP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERF2-1947HCL | Recombinant Human SERF2 293 Cell Lysate | +Inquiry |
NMD3-3793HCL | Recombinant Human NMD3 293 Cell Lysate | +Inquiry |
CD53-808MCL | Recombinant Mouse CD53 cell lysate | +Inquiry |
HOXD10-5412HCL | Recombinant Human HOXD10 293 Cell Lysate | +Inquiry |
AP1S1-8817HCL | Recombinant Human AP1S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cobD Products
Required fields are marked with *
My Review for All cobD Products
Required fields are marked with *
0
Inquiry Basket