Recombinant Full Length Cobalamin Biosynthesis Protein Cobd(Cobd) Protein, His-Tagged
Cat.No. : | RFL22553MF |
Product Overview : | Recombinant Full Length Cobalamin biosynthesis protein CobD(cobD) Protein (Q7VEN1) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MFASIWQTRAVGVLIGCLLDVVFGDPKRGHPVALFGRAAAKLEQITYRDGRVAGAVHVGL LVGAVGLLGAALQRLPGRCWPVAATATATWAALGGTSLARTGRQISDLLERDDVEAARRL LPSLCGRDPAQLGGPGLTRAALESVAENTADAQVVPLLWAASSGVPAVLGYRAINTLDSM IGYRSPRYLRFGWAAARLDDWANYVGARATAVLVVICAPVVGGSPRGAVRAWRRDAARHP SPNAGVVEAAFAGALDVRLGGPTRYHHELQIRPTLGDGRSPKVADLRRAVVLSRVVQAGA AVLAVMLVYRRRP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cobD |
Synonyms | cobD; BQ2027_MB2260C; Cobalamin biosynthesis protein CobD |
UniProt ID | Q7VEN1 |
◆ Recombinant Proteins | ||
FAM71C-1625R | Recombinant Rhesus monkey FAM71C Protein, His-tagged | +Inquiry |
ADIPOR2-9427H | Recombinant Human ADIPOR2, GST-tagged | +Inquiry |
GRN-28163TH | Recombinant Human GRN, FLAG-tagged | +Inquiry |
FABD-1026S | Recombinant Staphylococcus Aureus FABD Protein (1-308 aa), His-SUMO-tagged | +Inquiry |
PCOLCE-838H | Recombinant Human PCOLCE, T7-tagged | +Inquiry |
◆ Native Proteins | ||
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
GC-196H | Native Human Globulins Cohn fraction IV-4 protein | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYS1-5670HCL | Recombinant Human GYS1 293 Cell Lysate | +Inquiry |
PTPLAD2-2688HCL | Recombinant Human PTPLAD2 293 Cell Lysate | +Inquiry |
C11orf67-8339HCL | Recombinant Human C11orf67 293 Cell Lysate | +Inquiry |
LAMP2-987CCL | Recombinant Cynomolgus LAMP2 cell lysate | +Inquiry |
KRTAP11-1-4855HCL | Recombinant Human KRTAP11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cobD Products
Required fields are marked with *
My Review for All cobD Products
Required fields are marked with *
0
Inquiry Basket