Recombinant Full Length Cobalamin Biosynthesis Protein Cbib(Cbib) Protein, His-Tagged
Cat.No. : | RFL34297SF |
Product Overview : | Recombinant Full Length Cobalamin biosynthesis protein CbiB(cbiB) Protein (Q8Z5M7) (1-319aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-319) |
Form : | Lyophilized powder |
AA Sequence : | MTILAWCIAWVLDFIIGDPQHWPHPVRWIGRLITFVQRIVRRYCPGDKALRIGGGVMWVV VVGVTWGVAWGVLALAQRIHPWFGWSVEVWMIFTTLAGRSLARAAQEVERPLRENDLAES RIKLSWIVGRDTSQLQPAQIYRAVVETVAENTVDGIIAPLFFLFLGGAPLAMAYKAVNTL DSMVGYKHEKYRAIGMVSARMDDVANYLPARLSWLLLGIAAGLCRLSGWRALRIGWRDRY NHSSPNCAWSEACVAGALGIQLGGPNNYFGERVDKPWIGDAQRGISVDDISRTIRLMWVA STLALALFIAARCGLSGVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cbiB |
Synonyms | cbiB; STY2239; t0839; Cobalamin biosynthesis protein CbiB |
UniProt ID | Q8Z5M7 |
◆ Recombinant Proteins | ||
D2E76-5322M | Recombinant Mycobacteroides abscessus D2E76 protein, His&Myc-tagged | +Inquiry |
HDLBP-13719H | Recombinant Human HDLBP, GST-tagged | +Inquiry |
YOMI-0652B | Recombinant Bacillus subtilis YOMI protein, His-tagged | +Inquiry |
CXorf49B-3397H | Recombinant Human CXorf49B Protein, MYC/DDK-tagged | +Inquiry |
GPR17-2810H | Recombinant Human GPR17 Protein (Arg283-Leu367), N-GST tagged | +Inquiry |
◆ Native Proteins | ||
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
Proteoglycans-53H | Native Human Proteoglycans | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
APOA2-608H | Native Human Apolipoprotein A-II | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
GORASP1-5829HCL | Recombinant Human GORASP1 293 Cell Lysate | +Inquiry |
PRICKLE1-2871HCL | Recombinant Human PRICKLE1 293 Cell Lysate | +Inquiry |
INTS4-864HCL | Recombinant Human INTS4 cell lysate | +Inquiry |
HBA1-5624HCL | Recombinant Human HBA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cbiB Products
Required fields are marked with *
My Review for All cbiB Products
Required fields are marked with *
0
Inquiry Basket