Recombinant Full Length Clostridium Beijerinckii Glucitol/Sorbitol Permease Iic Component(Srla) Protein, His-Tagged
Cat.No. : | RFL21106CF |
Product Overview : | Recombinant Full Length Clostridium beijerinckii Glucitol/sorbitol permease IIC component(srlA) Protein (O32332) (1-182aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium beijerinckii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-182) |
Form : | Lyophilized powder |
AA Sequence : | MDAIVYFAKGFMYLFEVGGNTFVSWVTGIIPKVLLLLVFMNSIIAFIGQDKVDRFAKFAS RNVILAYGVLPFLSAFMLGNPMALSMGKFLPERMKPSYYASASYHCHTNSGIFPHINVGE IFIYLGIANGITTLGLDPTALGLRYLLVGLVMNFFAGWVTDFTTKIVMRQQGIELSNQLK AN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srlA |
Synonyms | srlA; gutA1; Cbei_0336; PTS system glucitol/sorbitol-specific EIIC component; EIIC-Gut; Glucitol/sorbitol permease IIC component |
UniProt ID | O32332 |
◆ Recombinant Proteins | ||
SSBA-0428B | Recombinant Bacillus subtilis SSBA protein, His-tagged | +Inquiry |
ISX-4628M | Recombinant Mouse ISX Protein, His (Fc)-Avi-tagged | +Inquiry |
SLU7-4327R | Recombinant Rhesus monkey SLU7 Protein, His-tagged | +Inquiry |
CELA1-1328R | Recombinant Rat CELA1 Protein | +Inquiry |
PANX2-6487M | Recombinant Mouse PANX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FTH1-28155TH | Native Human FTH1 | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
HPIV1ag-276V | Native Parainfluenza Virus type 1(strain Sendai) Protein | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
Amyloid P native protein-3441H | Native Human Amyloid P native protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZC3H8-205HCL | Recombinant Human ZC3H8 293 Cell Lysate | +Inquiry |
SLC2A4RG-1741HCL | Recombinant Human SLC2A4RG 293 Cell Lysate | +Inquiry |
FDX1-6270HCL | Recombinant Human FDX1 293 Cell Lysate | +Inquiry |
PTGFR-2711HCL | Recombinant Human PTGFR 293 Cell Lysate | +Inquiry |
BoneMarrow-455C | Cat Bone Marrow Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srlA Products
Required fields are marked with *
My Review for All srlA Products
Required fields are marked with *
0
Inquiry Basket