Recombinant Full Length Clostridium Acetobutylicum Protein Crcb Homolog 2(Crcb2) Protein, His-Tagged
Cat.No. : | RFL32239CF |
Product Overview : | Recombinant Full Length Clostridium acetobutylicum Protein CrcB homolog 2(crcB2) Protein (Q97IQ3) (1-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Acetobutylicum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-117) |
Form : | Lyophilized powder |
AA Sequence : | MDYFLIGIGGACGSIVRYKIGDIISKRTKSKFPWGTFIINITGAFLLGIITKSGAGKNLS MILADGFLGAYTTFSTFMYEGFNLFENKKKLNALIYILSSIIIGILGFYMGEFISQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crcB2 |
Synonyms | crcB2; CA_C1587; Putative fluoride ion transporter CrcB 2 |
UniProt ID | Q97IQ3 |
◆ Native Proteins | ||
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
Chitosan-002C | Native Crawfish Chitosan | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPA-3735HCL | Recombinant Human NPPA 293 Cell Lysate | +Inquiry |
STAMBP-1427HCL | Recombinant Human STAMBP 293 Cell Lysate | +Inquiry |
KCNK10-5039HCL | Recombinant Human KCNK10 293 Cell Lysate | +Inquiry |
HPN-5399HCL | Recombinant Human HPN 293 Cell Lysate | +Inquiry |
EIF3C-543HCL | Recombinant Human EIF3C cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crcB2 Products
Required fields are marked with *
My Review for All crcB2 Products
Required fields are marked with *
0
Inquiry Basket