Recombinant Full Length Classical Swine Fever Virus Genome Polyprotein Protein, His-Tagged
Cat.No. : | RFL2066CF |
Product Overview : | Recombinant Full Length Classical swine fever virus Genome polyprotein Protein (P19712) (3181-3898aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Classical swine fever virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (3181-3898) |
Form : | Lyophilized powder |
AA Sequence : | SNWVIQEENKQGSLAPLFEELLQQCPPGGQNKTTHMVSAYQLAQGNWVPVSCHVFMGTIP ARRTKTHPYEAYVKLRELVDEHKMKALCGGSGLSKHNEWVIGKVKYQGNLRTKHMLNPGK VAEQLHREGYRHNVYNKTIGSVMTATGIRLEKLPVVRAQTDTTNFHQAIRDKIDKEENLQ TPGLHKKLMEVFNALKRPELEASYDAVDWEELERGINRKGAAGFFERKNIGEVLDSEKNK VEEVIDSLKKGRNIRYYETAIPKNEKRDVNDDWTAGDFVDEKKPRVIQYPEAKTRLAITK VMYKWVKQKPVVIPGYEGKTPLFQIFDKVKKEWDQFQNPVAVSFDTKAWDTQVTTRDLEL IRDIQKFYFKKKWHKFIDTLTKHMSEVPVISADGEVYIRKGQRGSGQPDTSAGNSMLNVL TMVYAFCEATGVPYKSFDRVAKIHVCGDDGFLITERALGEKFASKGVQILYEAGKPQKIT EGDKMKVAYQFDDIEFCSHTPVQVRWSDNTSSYMPGRNTTTILAKMATRLDSSGERGTIA YEKAVAFSFLLMYSWNPLIRRICLLVLSTELQVRPGKSTTYYYEGDPISAYKEVIGHNLF DLKRTSFEKLAKLNLSMSTLGVWTRHTSKRLLQDCVNVGTKEGNWLVNADRLVSSKTGNR YIPGEGHTLQGKHYEELILARKPIGNFEGTDRYNLGPIVNVVLRRLKIMMMALIGRGV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Classical swine fever virus Genome polyprotein |
Synonyms | Genome polyprotein |
UniProt ID | P19712 |
◆ Recombinant Proteins | ||
RAC1-1845H | Recombinant Human RAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLK1-727H | Recombinant Human KLK1 Protein, GST-His-tagged | +Inquiry |
OSTM1-3076R | Recombinant Rhesus Macaque OSTM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIL3-3368R | Recombinant Rhesus Macaque PPIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRPA-2933S | Recombinant Staphylococcus epidermidis ATCC 12228 TRPA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLG-55H | Native Human lys-Plasminogen | +Inquiry |
Lectin-1845S | Active Native Soybean Agglutinin Protein, Agarose bound | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
PAK3-517HCL | Recombinant Human PAK3 cell lysate | +Inquiry |
ANGPT1-8863HCL | Recombinant Human ANGPT1 293 Cell Lysate | +Inquiry |
AKR1D1-8928HCL | Recombinant Human AKR1D1 293 Cell Lysate | +Inquiry |
Kidney-753B | Bovine Kidney Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Classical swine fever virus Genome polyprotein Products
Required fields are marked with *
My Review for All Classical swine fever virus Genome polyprotein Products
Required fields are marked with *
0
Inquiry Basket