Recombinant Full Length Clarias Gariepinus Gonadotropin-Releasing Hormone Ii Receptor Protein, His-Tagged
Cat.No. : | RFL6678CF |
Product Overview : | Recombinant Full Length Clarias gariepinus Gonadotropin-releasing hormone II receptor Protein (O42329) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clarias gariepinus (North African catfish) (Silurus gariepinus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MSGNTTLLLSNPTNVLDNSSVLNVSVSPPVLKWETPTFTTAARFRVAATLVLFVFAAASN LSVLLSVTRGRGRRLASHLRPLIASLASADLVMTFVVMPLDAVWNVTVQWYAGDAMCKLM CFLKLFAMHSAAFILVVVSLDRHHAILHPLDTLDAGRRNRRMLLTAWILSLLLASPQLFI FRAIKAKGVDFVQCATHGSFQQHWQETAYNMFHFVTLYVFPLLVMSLCYTRILVEINRQM HRSKDKAGEPCLRRSGTDMIPKARMKTLKMTIIIVASFVICWTPYYLLGIWYWFQPQMLH VIPDYVHHVFFVFGNLNTCCDPVIYGFFTPSFRADLSRCFCWRNQNASAKSLPHFSGHRR EVSGEAESDLGSGDQPSGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Clarias gariepinus Gonadotropin-releasing hormone II receptor |
Synonyms | Gonadotropin-releasing hormone II receptor; GnRH II receptor; GnRH-II-R; Type II GnRH receptor |
UniProt ID | O42329 |
◆ Recombinant Proteins | ||
ORC5-6406M | Recombinant Mouse ORC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
NI36-RS03880-0722S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS03880 protein, His-tagged | +Inquiry |
TOMM40L-12208Z | Recombinant Zebrafish TOMM40L | +Inquiry |
RFL5599HF | Recombinant Full Length Human Mitochondrial Carrier Triple Repeat Protein 6(Mcart6) Protein, His-Tagged | +Inquiry |
MRFAP1L1-5470H | Recombinant Human MRFAP1L1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
VLDL-252H | Native Human Very Low Density Lipoprotein | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
CRYGD-01B | Native Bovine CRYGD protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-261H | Human Kidney Lupus Lysate | +Inquiry |
SLC45A2-1634HCL | Recombinant Human SLC45A2 cell lysate | +Inquiry |
COPG-7360HCL | Recombinant Human COPG 293 Cell Lysate | +Inquiry |
DRD1-6818HCL | Recombinant Human DRD1 293 Cell Lysate | +Inquiry |
TGFBI-2766HCL | Recombinant Human TGFBI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Clarias gariepinus Gonadotropin-releasing hormone II receptor Products
Required fields are marked with *
My Review for All Clarias gariepinus Gonadotropin-releasing hormone II receptor Products
Required fields are marked with *
0
Inquiry Basket