Recombinant Full Length Citrobacter Koseri Phosphoglycerol Transferase I(Mdob) Protein, His-Tagged
Cat.No. : | RFL27383CF |
Product Overview : | Recombinant Full Length Citrobacter koseri Phosphoglycerol transferase I(mdoB) Protein (A8AM07) (1-763aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Citrobacter koseri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-763) |
Form : | Lyophilized powder |
AA Sequence : | MSELLSIALFLASVLIYAWKAGRNTWWFAAILAVLGLFVVLNITLYASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGAGIVLALAAVFSALGWVLRRRRHHPHHFGYSLLALLLALG SVDASPAFRQISELVKSQSRDGDPDFPAYYKEPSKTIPNPQLNLVYIYGESLERTYFDND AFPDLTPELGALKNEGLDFSHTMQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGAEELKTVVADPSYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKRYDFDGKPNQS FSAVSCSQENIAEFINKIKASPWFKNTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVLRG DQPQQDTLAVKRNTMDNGATVLDILGGDNFIGLGRSSLSGQSLSEVFLNSKEKILAMKPD IIRLWNFPKEMKDFTVDRDKDMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA NFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQSIQHVDKAQWKGKTAFKD TVIDMERYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYNTPLPKKFDLVITAKAFGANANRPIPVRVGKEEQTLVLENEVTTTTLHFDNP SNASTLVIVPPDPVSTNEGNILGHSPRKLGIGMVEIKVVNAEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdoB |
Synonyms | mdoB; opgB; CKO_03440; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase |
UniProt ID | A8AM07 |
◆ Recombinant Proteins | ||
CADPS-580H | Recombinant Human CADPS Protein, His/GST-tagged | +Inquiry |
KIR3DX1-4830HF | Recombinant Full Length Human KIR3DX1 Protein, GST-tagged | +Inquiry |
RFL21767BF | Recombinant Full Length Bacteroides Vulgatus Upf0059 Membrane Protein Bvu_2631 (Bvu_2631) Protein, His-Tagged | +Inquiry |
HGF-152C | Recombinant Cynomolgus HGF, None tagged | +Inquiry |
CD79A-5371H | Recombinant Human CD79A Protein (Met1-Arg143), C-His tagged | +Inquiry |
◆ Native Proteins | ||
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
IgG-010E | Native Horse Whole Molecule IgG, Biotin Conjugated | +Inquiry |
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
Lectin-1730P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARP8-1285HCL | Recombinant Human PARP8 cell lysate | +Inquiry |
SCARB1-2684MCL | Recombinant Mouse SCARB1 cell lysate | +Inquiry |
MUTED-4053HCL | Recombinant Human MUTED 293 Cell Lysate | +Inquiry |
PSTK-514HCL | Recombinant Human PSTK lysate | +Inquiry |
RNPS1-2259HCL | Recombinant Human RNPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mdoB Products
Required fields are marked with *
My Review for All mdoB Products
Required fields are marked with *
0
Inquiry Basket