Recombinant Full Length Chrysanthemum Virus B Movement Protein Tgb2 (Orf3) Protein, His-Tagged
Cat.No. : | RFL8917CF |
Product Overview : | Recombinant Full Length Chrysanthemum virus B Movement protein TGB2 (ORF3) Protein (P37989) (1-106aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chrysanthemum virus B (CVB) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-106) |
Form : | Lyophilized powder |
AA Sequence : | MPLTPPPDHTKVLLVAAIGLSIVASILTYSRNTLPQVGDHSHLLPHGGVYKDGTKTIVYG GPRKLNSLEGGFNLPVQPWFLVILLSAAIFLLSCRSGHRRVCGQCH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF3 |
Synonyms | ORF3; Movement protein TGB2; 12 kDa protein; Triple gene block 2 protein; TGBp2 |
UniProt ID | P37989 |
◆ Recombinant Proteins | ||
GSX2-4396H | Recombinant Human GSX2 Protein, GST-tagged | +Inquiry |
TRIM56-17383M | Recombinant Mouse TRIM56 Protein | +Inquiry |
RFL36222DF | Recombinant Full Length Dichelobacter Nodosus Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
AQP8B-6496Z | Recombinant Zebrafish AQP8B | +Inquiry |
GHRH-2185R | Recombinant Rat GHRH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TIMP2-8460H | Native Human TIMP2 | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
PGI-241H | Native Human Pepsinogen I | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
K-562-887H | K-562 (human chronic myelogenous leukemia) nuclear extract lysate | +Inquiry |
FBXW7-6282HCL | Recombinant Human FBXW7 293 Cell Lysate | +Inquiry |
CD200-2638MCL | Recombinant Mouse CD200 cell lysate | +Inquiry |
POLE-1390HCL | Recombinant Human POLE cell lysate | +Inquiry |
FAM54A-6368HCL | Recombinant Human FAM54A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ORF3 Products
Required fields are marked with *
My Review for All ORF3 Products
Required fields are marked with *
0
Inquiry Basket