Recombinant Full Length Chromobacterium Violaceum Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL17629CF |
Product Overview : | Recombinant Full Length Chromobacterium violaceum Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q7NZD1) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chromobacterium violaceum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MSISRSLKIVATLYRYGLDDFLEGHSRLAFLHKLFGLCPVRRDTSAPLPQRVRLALESLG PIFVKFGQVLSTRRDLLPPEYADELALLQDRVPPFDGDIARQVVERSLGRKVEELFVDFD LKPVASASVAQVHKAWLRQPDGGRGREVAVKVLRPGILPVIEQDLSLMRTLAGWVEKLFA DGKRLKPREVVAEFDKYLHDELDMMHEAANASQLRRNFKGSDMLIVPEVFYDYSSREVLT LEWMHGIPVGQIERLREAGVDLQKLSRFGVEIFFTQVFRHGFFHADMHPGNIFVAADGRY IALDFGIVGSLTDTDKHYLAVNFLAFFNRDYHRVATAHIESGWVPRDTRAEELEAAVRTV CEPIFEKPLSEISFGMVLLRLFETSRRFNVEIQPQLVLLQKTLLNIEGLGRQLDPELDLW DTAKPFLTKWMNEQIGWRGLLRTLKHEAPQWATTLPTLPRKLNEALGSAKTDLLVEGYIQ LMREQKRQNFLLLLIAILLAALLAKSLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; CV_0991; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | Q7NZD1 |
◆ Recombinant Proteins | ||
ADAP1-2483H | Recombinant Human ADAP1 protein, GST-tagged | +Inquiry |
SGR-RS13950-898S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS13950 protein, His-tagged | +Inquiry |
CYP20A1-2825H | Recombinant Human CYP20A1 protein, His-tagged | +Inquiry |
CDKN2A-655H | Recombinant Human CDKN2A protein | +Inquiry |
Fntb-476M | Recombinant Mouse Fntb Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF2-5366HCL | Recombinant Human HSF2 293 Cell Lysate | +Inquiry |
Fetal Ovary -151H | Human Fetal Ovary Cytoplasmic Lysate | +Inquiry |
CLEC14A-2579MCL | Recombinant Mouse CLEC14A cell lysate | +Inquiry |
SPRYD4-1488HCL | Recombinant Human SPRYD4 293 Cell Lysate | +Inquiry |
DEPDC7-6972HCL | Recombinant Human DEPDC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket