Recombinant Full Length Choristoneura Fumiferana Nuclear Polyhedrosis Virus Major Envelope Glycoprotein(Gp67) Protein, His-Tagged
Cat.No. : | RFL6044CF |
Product Overview : | Recombinant Full Length Choristoneura fumiferana nuclear polyhedrosis virus Major envelope glycoprotein(GP67) Protein (P41717) (18-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Choristoneura fumiferana nuclear polyhedrosis virus (CfMNPV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-509) |
Form : | Lyophilized powder |
AA Sequence : | AEHCNAQMNSGPWRIKNLSIAPPKETLQKDVEIEIVETNMDENVIIGYKGYYQAYAYNGG SLDPNTRIEETMETLNVAKEDLLMWSIRRQCEVGEELIDQWGSDSDNCFRNKDGRGVWVF GKELVKRQNNNHFARHTCNRSWRCGVSTAKMYTRLECDNDNDECKVTILDINGASINVTE NTVLHRDGVSMVLKQKSTFSRRPEKVACLLIKDDKSDPRSVTREHCLVDNDIFDLSKNTW LCKFNRCIKRKSENVVKQRPPTWRHDVSAKHDEGASATKGDLMHIQEELMYENDLLRMNL ELMHAHINKLNNMLHNLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTHPPPHTS NCYNNSIYKEGRWVANTDSSQCIDFNNYKELAIDDDIEFWIPTIGNTTYHENWKDASGWS FIAQQKSNLISTMENTKFGGHTTSLSDITDMAKGELNAKLWSFMLGHAFSFMLTVGVIIF LFCMVRNRSRAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GP67 |
Synonyms | GP67; P67; Major envelope glycoprotein; gp67 |
UniProt ID | P41717 |
◆ Recombinant Proteins | ||
IL6-163H | Active Recombinant Human Interleukin 6, HIgG1 Fc-tagged | +Inquiry |
CLCN7-1428R | Recombinant Rat CLCN7 Protein | +Inquiry |
PCNA-5744C | Recombinant Chicken PCNA | +Inquiry |
TCOF1-10H | Recombinant Human TCOF1 protein, His-tagged | +Inquiry |
XRE-1072B | Recombinant Bacillus subtilis XRE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
MV-01 | Native Measles Virus Antigen (Premium) | +Inquiry |
Lectin-1784G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 649 Labeled | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
LTF-312H | Native Human LTF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA3E-657HCL | Recombinant Human TUBA3E 293 Cell Lysate | +Inquiry |
ADO-9007HCL | Recombinant Human ADO 293 Cell Lysate | +Inquiry |
KIT-463HCL | Recombinant Human KIT cell lysate | +Inquiry |
EPN1-6581HCL | Recombinant Human EPN1 293 Cell Lysate | +Inquiry |
MDGA2-2265MCL | Recombinant Mouse MDGA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GP67 Products
Required fields are marked with *
My Review for All GP67 Products
Required fields are marked with *
0
Inquiry Basket