Recombinant Full Length Chlorokybus Atmophyticus Peptidoglycan Synthase Ftsi Homolog(Ftsi) Protein, His-Tagged
Cat.No. : | RFL18828CF |
Product Overview : | Recombinant Full Length Chlorokybus atmophyticus Peptidoglycan synthase ftsI homolog(ftsI) Protein (A2CI41) (1-679aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorokybus atmophyticus (Soil alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-679) |
Form : | Lyophilized powder |
AA Sequence : | MKPYEPKSWVTRVFLVWWLTALSCFFISGRLIYLQLLKGKWLKEKALKQQTVTLKTFQPR RNICDRNGIPLAIDTLAYDVFAHPLYFSISIEEVANKLSPILCIDSLSIQKLLKPTSTGI CLASQLPENTGKLIASLRLDGIDLIKHPKRYYPYKEIVGNVIGYVDTSHQGQAGIELSCQ ESLQLNSPTLTSSIDGRGVLISHQIPKELFIQDNLSLQLTLDLELQKIAYKALKQGLENC KGKRGTVLILDPKTGGILTLVALPSYDPNIYYDFPIERFKPWPVTDLYEPGSTFKPLNIA IALETKAISPEDSFYDEGCIRVGDSIITNNDYNSYKPLPCLPNTYNKIVKLLANSSNVGM VHILERIAPEIYHSWLSKLDLGHAASPLETDLPWASESSLKDINEFVCYEIEPAAASFGQ GLAMTPIKLAQLYASLANGGILVKPYLVTGLANAAEDTQKAKGIDLPSYNIRKKNLGNHL SWHKAEPSYLFLKRSGIRVTDLLRHIKAEGRFALPFRKNLLQLFTQDAHRTTELQLEPKA HQPQLLRPTRHAVYATNQSKRVFSHETTKLLLDMLEDVIWNGTGSSCFVEGYRIGGKTGT SQKHTQEGGYSKTKIITSFAAIFPTEDPQYVILTVIDEPNIPLSFGSNTAAPIVKSIIES LIDIKKMKPTIPIIKVKKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsI |
Synonyms | ftsI; Peptidoglycan D,D-transpeptidase FtsI homolog |
UniProt ID | A2CI41 |
◆ Recombinant Proteins | ||
PPARGC1A-32H | Recombinant Human PPARG coactivator 1 alpha Protein, His tagged | +Inquiry |
AK5-393H | Recombinant Human AK5 Protein, GST-tagged | +Inquiry |
SNRPA-6685H | Recombinant Human SNRPA protein, His-tagged | +Inquiry |
IGFBP7-5054H | Recombinant Human Insulin-Like Growth Factor Binding Protein 7 | +Inquiry |
PRIM1-7082M | Recombinant Mouse PRIM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-340G | Native Goat IgG | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
WIM-5415B | Native Bovine Vimentin | +Inquiry |
CA72-4-160H | Native Human Cancer Antigen 72-4 | +Inquiry |
LDL-394H | Native Human Low Density Lipoprotein, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGL-8980HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
Corpus Callosum-100H | Human Corpus Callosum (Alzheimers Disease) Lysate | +Inquiry |
GP1BA-5823HCL | Recombinant Human GP1BA 293 Cell Lysate | +Inquiry |
MPP1-4233HCL | Recombinant Human MPP1 293 Cell Lysate | +Inquiry |
KIAA1586-4961HCL | Recombinant Human KIAA1586 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsI Products
Required fields are marked with *
My Review for All ftsI Products
Required fields are marked with *
0
Inquiry Basket