Recombinant Full Length Chloroherpeton Thalassium Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL33815CF |
Product Overview : | Recombinant Full Length Chloroherpeton thalassium Undecaprenyl-diphosphatase(uppP) Protein (B3QW96) (1-283aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chloroherpeton thalassium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-283) |
Form : | Lyophilized powder |
AA Sequence : | MDIIQAIVLGIIQGLTEFLPISSSAHLRIFPALLGWDDPGAAFTAIIQIGTLAAVLIYFY QDILRITSATISGLVNRNPFGSQDSRMGWMISAGTIPIVVLGLLFKKNIETTFRSLYIIS GSLILLALVLMYAEYLVKKREARGEKMLSLDKVDWKEAIIIGLAQSLALIPGSSRSGTTI TGGLFLGMTRETAARFSFLLSLPAVFAAGVYQLLKVWPELMASGDELVNLTVATVVSGVI GYASIAFLLDYLKKHSTYLFIIYRILLGVFLLAMLSMGKLEAF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Ctha_0740; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | B3QW96 |
◆ Recombinant Proteins | ||
TELO2-1975HFL | Recombinant Full Length Human TELO2 Protein, C-Flag-tagged | +Inquiry |
MRPL52-1015H | Recombinant Human MRPL52, GST-tagged | +Inquiry |
CCL28-149H | Active Recombinant Human CCL28, HIgG1 Fc-tagged | +Inquiry |
Sap30bp-5686M | Recombinant Mouse Sap30bp Protein, Myc/DDK-tagged | +Inquiry |
SAP052A-037-2264S | Recombinant Staphylococcus aureus (strain: NE 3885) SAP052A_037 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
Collagen-317B | Native Bovine Collagen Type I | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
C3orf14-8054HCL | Recombinant Human C3orf14 293 Cell Lysate | +Inquiry |
SPINLW1-1508HCL | Recombinant Human SPINLW1 293 Cell Lysate | +Inquiry |
AKD1-8935HCL | Recombinant Human AKD1 293 Cell Lysate | +Inquiry |
TBCCD1-1217HCL | Recombinant Human TBCCD1 293 Cell Lysate | +Inquiry |
Kidney-753B | Bovine Kidney Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket