Recombinant Full Length Chlorobium Phaeobacteroides Upf0761 Membrane Protein Cpha266_1653 (Cpha266_1653) Protein, His-Tagged
Cat.No. : | RFL10387CF |
Product Overview : | Recombinant Full Length Chlorobium phaeobacteroides UPF0761 membrane protein Cpha266_1653 (Cpha266_1653) Protein (A1BGZ7) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlorobium phaeobacteroides |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MFEGIGGETLWRKEKQRPVKELIDFHMDWLHKKNEHDEWLSDRDGELYIRVFFPFFWKNF IHDKIFLSAGSLAFQSLLSLVPLLSVTLSILRVFPVFESLNRYLEDYVLQNFIPGTGTML REYLNAFIDKTSSVPLLGVVFLFIIALSLISTIDHTLNEIWEVYAPRKIVQGFTLYWTVL TLGPVLIGSSLVASSFVWYTVFTEGPLLELKTRLLSFLPFLNSVIAFFLLYMLVPNRRVR FYHAVYGSLLAAVLFELSKKWFVFYVSHFATFEYIYGALSVIPMLFFWIYLEWVVVLTGA EFVFCLGSLKPKKSISEPFDPMRGIDEILVVLGWIWEGQKTGTPLSMKSIMKKKRALQPS RARSIVDLLLQAGIVHGTANAGFAVSSDLYETTLFDLYTKIPGGFGANESETRGNGGAIL PESIGHNVTAGIKSAMTIPLATVLQDKIY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cpha266_1653 |
Synonyms | Cpha266_1653; UPF0761 membrane protein Cpha266_1653 |
UniProt ID | A1BGZ7 |
◆ Recombinant Proteins | ||
Spike-240V | Recombinant COVID-19 S protein (R667A), His-tagged | +Inquiry |
ROGDI-1237H | Recombinant Human ROGDI | +Inquiry |
C1QBP-27465TH | Recombinant Human C1QBP Protein | +Inquiry |
Ceacam19-2098M | Recombinant Mouse Ceacam19 Protein, Myc/DDK-tagged | +Inquiry |
SLC45A4-8381M | Recombinant Mouse SLC45A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
TF-321H | Native Human Transferrin Rhodamine | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL13-4912HCL | Recombinant Human KLHL13 293 Cell Lysate | +Inquiry |
AAK1-2106HCL | Recombinant Human AAK1 cell lysate | +Inquiry |
C3orf37-8045HCL | Recombinant Human C3orf37 293 Cell Lysate | +Inquiry |
DDX31-7009HCL | Recombinant Human DDX31 293 Cell Lysate | +Inquiry |
TMEM106B-1016HCL | Recombinant Human TMEM106B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cpha266_1653 Products
Required fields are marked with *
My Review for All Cpha266_1653 Products
Required fields are marked with *
0
Inquiry Basket