Recombinant Full Length Chlamydomonas Reinhardtii Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged
Cat.No. : | RFL22096CF |
Product Overview : | Recombinant Full Length Chlamydomonas reinhardtii Photosystem II D2 protein(psbD) Protein (P06007) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydomonas reinhardtii (Chlamydomonas smithii) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MTIAIGTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWLTGTTFVTSWYT HGLATSYLEGCNFLTAAVSTPANSMAHSLLFVWGPEAQGDFTRWCQLGGLWAFVALHGAF GLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFR FILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQA EETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFVS QEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbD |
Synonyms | psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein |
UniProt ID | P06007 |
◆ Native Proteins | ||
Trypsin-51P | Active Native Porcine Trypsin | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
Mannose Binding Lectin-044H | Native Human Mannose Binding Lectin Protein | +Inquiry |
KRT19-5H | Native Human CK19 | +Inquiry |
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2D-4374HCL | Recombinant Human MEF2D 293 Cell Lysate | +Inquiry |
HepG2-040WCY | Human hepatocellular liver carcinoma HepG2 Whole Cell Lysate | +Inquiry |
TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
EIF4G3-6645HCL | Recombinant Human EIF4G3 293 Cell Lysate | +Inquiry |
FGF18-2430MCL | Recombinant Mouse FGF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbD Products
Required fields are marked with *
My Review for All psbD Products
Required fields are marked with *
0
Inquiry Basket