Recombinant Full Length Chlamydia Trachomatis Serovar E Deubiquitinase And Deneddylase Dub1(Cdu1) Protein, His-Tagged
Cat.No. : | RFL35832CF |
Product Overview : | Recombinant Full Length Chlamydia trachomatis serovar E Deubiquitinase and deneddylase Dub1(cdu1) Protein (D3UTF4) (1-418aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia trachomatis serovar E |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-418) |
Form : | Lyophilized powder |
AA Sequence : | MLSPTNSTSKTAPVPPQDSSKPVLISEEPQNQLLQKVARTALVVLLVVVTLGLILLFYSF SDLQSFPWCCQTRPSTKEQPTISIPVPLPSPPLAVPRPSTPPPPVISRPSMPPAPTPAIS PPSTPSAPKPSTPPPLPPKAPKPVKTQEDLLPFVPEQVFVEMYEDMARRRTIEALVPAWD SDIIFKCLCYFHTLYQGLIPLETFPPATIFNFKQKIISILEDKKAVLRGEPIKGSLPICC SEENYRRHLHGTTLLPVFMWYHPTPKTLSDTMQTMKQLAIKGSVGASHWLLVIVDIQARR LVYFDSLYNYVMSPEDMEKDLQSFAQQLDQVYPAYDSQKFSVKIAAKEVIQKGSGSSCGA WCCQFLHWYLRDPFTDALNDLPVDSVERHENLASFVQACEAAVQDLPELFWPEAKALF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cdu1 |
Synonyms | cdu1; SW2_8841; Deubiquitinase and deneddylase Dub1; ChlaDub1 |
UniProt ID | D3UTF4 |
◆ Recombinant Proteins | ||
SMN1-151H | Recombinant Human SMN1 Protein, DYKDDDDK-tagged | +Inquiry |
TMEM27-528H | Recombinant Human TMEM27 Protein, His-tagged | +Inquiry |
CD37-71H | Recombinant Human CD37 protein, Fc-tagged | +Inquiry |
SCHIP1-5335H | Recombinant Human SCHIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL22685CF | Recombinant Full Length Dog Prostaglandin E Synthase(Ptges) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
Urease-53J | Active Native Jack Bean Urease | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-205H | Human Heart Interventricular Septum (Arrhythmia, infarct) Lysate | +Inquiry |
AVPI1-8558HCL | Recombinant Human AVPI1 293 Cell Lysate | +Inquiry |
ZBTB8A-210HCL | Recombinant Human ZBTB8A 293 Cell Lysate | +Inquiry |
GDAP2-5972HCL | Recombinant Human GDAP2 293 Cell Lysate | +Inquiry |
HAS3-5633HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cdu1 Products
Required fields are marked with *
My Review for All cdu1 Products
Required fields are marked with *
0
Inquiry Basket